AlertsPlugin&AlertW&aarschuwingShow an alert message.Toon waarschuwingsberichten.<strong>Alerts Plugin</strong><br />The alert plugin controls the displaying of alerts on the display screen.<strong>Waarschuwingsplug-in</strong><br />De waarschuwingsplug-in regelt de weergave van waarschuwingen op het scherm.Alertname singularWaarschuwingAlertsname pluralWaarschuwingenAlertscontainer titleWaarschuwingenAlertsPlugin.AlertFormAlert MessageWaarschuwingAlert &text:Waarschuwings&tekst:&Parameter:&Parameter:&New&Nieuw&SaveOp&slaanDispl&ayWee&rgevenDisplay && Cl&ose&Weergeven && sluitenNew AlertNieuwe waarschuwingYou haven't specified any text for your alert.
Please type in some text before clicking New.De waarschuwingstekst is leeg.
Voer eerst tekst in voordat u op Nieuw klikt. No Parameter FoundGeen parameters gevondenYou have not entered a parameter to be replaced.
Do you want to continue anyway?U heeft geen parameter opgegeven die vervangen moet worden.
Toch doorgaan?No Placeholder FoundGeen tijdelijke aanduiding gevondenThe alert text does not contain '<>'.
Do you want to continue anyway?De waarschuwingstekst bevat geen '<>'.
Wilt u toch doorgaan?AlertsPlugin.AlertsManagerAlert message created and displayed.Waarschuwing gemaakt en weergegeven.AlertsPlugin.AlertsTabFont SettingsFont name:Naam lettertype:Font color:Letterkleur:Font size:Lettergrootte:Background SettingsOther SettingsAlert timeout:Tijdsduur:Repeat (no. of times):Enable ScrollingBiblesPlugin&Bible&Bijbel<strong>Bible Plugin</strong><br />The Bible plugin provides the ability to display Bible verses from different sources during the service.<strong>Bijbelplug-in</strong><br />De Bijbelplug-in voorziet in de mogelijkheid bijbelteksten uit verschillende bronnen weer te geven tijdens de dienst.Biblename singularBijbelBiblesname pluralBijbelsBiblescontainer titleBijbelsImport a Bible.Importeer een bijbel.Add a new Bible.Voeg een nieuwe bijbel toe.Edit the selected Bible.Geselecteerde bijbel bewerken.Delete the selected Bible.Geselecteerde bijbel verwijderen.Preview the selected Bible.Geselecteerde bijbeltekst in voorbeeldscherm tonen.Send the selected Bible live.Geselecteerde bijbeltekst live tonen.Add the selected Bible to the service.Geselecteerde bijbeltekst aan de liturgie toevoegen.GenesisGenesisExodusExodusLeviticusLeviticusNumbersNumeriDeuteronomyDeuteronomiumJoshuaJozuaJudgesRechtersRuthRuth1 Samuel1 Samuel2 Samuel2 Samuel1 Kings1 Koningen2 Kings2 Koningen1 Chronicles1 Kronieken2 Chronicles2 KroniekenEzraEzraNehemiahNehemiaEstherEsterJobJobPsalmsPsalmenProverbsSpreukenEcclesiastesPredikerSong of SolomonHoogliedIsaiahJesajaJeremiahJeremiaLamentationsKlaagliederenEzekielEzechiëlDanielDaniëlHoseaHoseaJoelJoëlAmosAmosObadiahObadjaJonahJonaMicahMichaNahumNahumHabakkukHabakukZephaniahSefanjaHaggaiHaggaiZechariahZachariaMalachiMaleachiMatthewMatteüsMarkMarcusLukeLucasJohnJohannesActsHandelingenRomansRomeinen1 Corinthians1 Korintiërs2 Corinthians2 KorintiërsGalatiansGalatenEphesiansEfeziërsPhilippiansFilippenzenColossiansKolossenzen1 Thessalonians1 Tessalonicenzen2 Thessalonians2 Tessalonicenzen1 Timothy1 Timoteüs2 Timothy2 TimoteüsTitusTitusPhilemonFilemonHebrewsHebreeënJamesJakobus1 Peter1 Petrus2 Peter2 Petrus1 John1 Johannes2 John2 Johannes3 John3 JohannesJudeJudasRevelationOpenbaringJudithJuditWisdomWijsheidTobitTobitSirachSirachBaruchBaruch1 Maccabees1 Makkabeeën2 Maccabees2 Makkabeeën3 Maccabees3 Makkabeeën4 Maccabees4 MakkabeeënRest of DanielToevoegingen aan DaniëlRest of EstherEster (Grieks)Prayer of ManassesManasseLetter of JeremiahBrief van JeremiaPrayer of AzariahGebed van AzariaSusannaSusannaBelBel en de draak1 Esdras1 Esdras2 Esdras2 Esdras:Verse identifier e.g. Genesis 1 : 1 = Genesis Chapter 1 Verse 1:vVerse identifier e.g. Genesis 1 v 1 = Genesis Chapter 1 Verse 1vVVerse identifier e.g. Genesis 1 V 1 = Genesis Chapter 1 Verse 1VverseVerse identifier e.g. Genesis 1 verse 1 = Genesis Chapter 1 Verse 1versversesVerse identifier e.g. Genesis 1 verses 1 - 2 = Genesis Chapter 1 Verses 1 to 2verzen-range identifier e.g. Genesis 1 verse 1 - 2 = Genesis Chapter 1 Verses 1 To 2-torange identifier e.g. Genesis 1 verse 1 - 2 = Genesis Chapter 1 Verses 1 To 2tot,connecting identifier e.g. Genesis 1 verse 1 - 2, 4 - 5 = Genesis Chapter 1 Verses 1 To 2 And Verses 4 To 5,andconnecting identifier e.g. Genesis 1 verse 1 - 2 and 4 - 5 = Genesis Chapter 1 Verses 1 To 2 And Verses 4 To 5enendending identifier e.g. Genesis 1 verse 1 - end = Genesis Chapter 1 Verses 1 To The Last VerseeindeNo Book FoundGeen bijbelboek gevondenNo matching book could be found in this Bible. Check that you have spelled the name of the book correctly.Er kon geen bijbelboek met die naam gevonden worden. Controleer de spelling.The proxy server {proxy} was found in the bible {name}.<br>Would you like to set it as the proxy for OpenLP?bothBiblesPlugin.BibleEditFormYou need to specify a version name for your Bible.U moet een naam opgeven voor deze versie van de bijbel.You need to set a copyright for your Bible. Bibles in the Public Domain need to be marked as such.U moet opgeven welke copyrights gelden voor deze bijbelvertaling. Bijbels in het publieke domein moeten als zodanig gemarkeerd worden.Bible ExistsBijbel bestaat alThis Bible already exists. Please import a different Bible or first delete the existing one.Deze bijbelvertaling bestaat reeds. Importeer een andere vertaling of verwijder eerst de bestaande versie.You need to specify a book name for "{text}".The book name "{name}" is not correct.
Numbers can only be used at the beginning and must
be followed by one or more non-numeric characters.Duplicate Book NameDuplicaat gevondenThe Book Name "{name}" has been entered more than once.BiblesPlugin.BibleImportThe file "{file}" you supplied is compressed. You must decompress it before import.unknown type ofThis looks like an unknown type of XML bible.onbekend typeBiblesPlugin.BibleManagerWeb Bible cannot be used in Text SearchText Search is not available with Web Bibles.
Please use the Scripture Reference Search instead.
This means that the currently selected Bible is a Web Bible.Scripture Reference ErrorFout in schriftverwijzing<strong>The reference you typed is invalid!<br><br>Please make sure that your reference follows one of these patterns:</strong><br><br>%sBiblesPlugin.BiblesTabVerse DisplayBijbeltekst weergaveShow verse numbersToon versnummersOnly show new chapter numbersToon alleen nieuw hoodstuknummerBible theme:Bijbel thema:No BracketsGeen haakjes( And )( en ){ And }{ en }[ And ][ en ]Note: Changes do not affect verses in the ServiceDisplay second Bible versesToon tweede bijbelvertalingCustom Scripture ReferencesAangepaste schriftverwijzingenVerse separator:Range separator:List separator:End mark:Multiple alternative verse separators may be defined.
They have to be separated by a vertical bar "|".
Please clear this edit line to use the default value.Meerdere alternatieve vers-scheidingstekens mogen worden opgegeven.
Ze moeten gescheiden worden door een verticale streep "|".
Maak de regel leeg om de standaardinstelling te gebruiken.Default Bible LanguageStandaardtaal bijbelBook name language in search field,
search results and on display:Taal van de namen van bijbelboeken in zoekvelden,
zoekresultaten en in weergave:Bible LanguageTaal bijbelApplication LanguageProgrammataalEnglishDutchQuick Search SettingsReset search type to "Text or Scripture Reference" on startupDon't show error if nothing is found in "Text or Scripture Reference"Search automatically while typing (Text search must contain a
minimum of {count} characters and a space for performance reasons)BiblesPlugin.BookNameDialogSelect Book NameSelecteer naam bijbelboekThe following book name cannot be matched up internally. Please select the corresponding name from the list.Voor de volgende namen van bijbelboeken is geen passend alternatief. Selecteer het juiste bijbelboek uit de lijst.Current name:Huidige naam:Corresponding name:Overeenkomstige naam:Show Books FromToon boeken uitOld TestamentOude TestamentNew TestamentNieuwe TestamentApocryphaApocriefe boekenBiblesPlugin.BookNameFormYou need to select a book.Selecteer een boek.BiblesPlugin.CSVBibleImporting books... {book}Importing verses from {book}...Importing verses from <book name>...Importeren verzen van {book}...BiblesPlugin.EditBibleFormBible EditorBijbel editorLicense DetailsLicentiedetailsVersion name:Versie naam:Copyright:Copyright:Permissions:Rechten:Full license:Default Bible LanguageStandaardtaal bijbelBook name language in search field, search results and on display:Taal van de namen van bijbelboeken in zoekvelden, zoekresultaten en in weergave:Global SettingsGlobale instellingenBible LanguageTaal bijbelApplication LanguageProgrammataalEnglishDutchThis is a Web Download Bible.
It is not possible to customize the Book Names.Deze bijbelvertaling is een download-bijbel.
De namen van bijbelboeken kunnen niet aangepast worden.To use the customized book names, "Bible language" must be selected on the Meta Data tab or, if "Global settings" is selected, on the Bible page in Configure OpenLP.Om aangepaste namen voor bijbelboeken te gebruiken, moet "Bijbeltaal" geselecteerd zijn op het tabblad "Algemene informatie" of, als "Globale instellingen" is geselecteerd, op de "Bijbel" pagina in "Instellingen".BiblesPlugin.HTTPBibleRegistering Bible and loading books...Bezig met registreren van bijbel en laden van boeken...Registering Language...Bezig met registreren van de taal...Importing {book}...Importing <book name>...Importeren {book}...Download ErrorDownloadfoutThere was a problem downloading your verse selection. Please check your Internet connection, and if this error continues to occur, please consider reporting a bug.Parse ErrorVerwerkingsfoutThere was a problem extracting your verse selection. If this error continues to occur please consider reporting a bug.Er is een fout opgetreden bij het uitpakken van de bijbelverzen. Als dit probleem zich blijft herhalen is er misschien sprake van een programmafout.BiblesPlugin.ImportWizardFormCSV FileCSV bestandBible Import WizardBijbel Import AssistentThis wizard will help you to import Bibles from a variety of formats. Click the next button below to start the process by selecting a format to import from.Deze Assistent helpt u bijbels van verschillende bestandsformaten te importeren. Om de Assistent te starten klikt op volgende.Web DownloadOnlinebijbelBible file:Bijbel bestand:Books file:Bijbelboeken bestand:Verses file:Bijbelverzen bestand:Location:Locatie:Click to download bible listKlik om de bijbellijst te downloadenDownload bible listDownload bijbellijstCrosswalkCrosswalkBibleGatewayBibleGatewayBibleserverBibleserver.comBible:Bijbelvertaling:Bibles:Bijbels:SWORD data folder:SWORD datamap:SWORD zip-file:SWORD zip-bestand:Import from folderImporteren vanuit mapImport from Zip-fileImporteren vanuit zip-bestandTo import SWORD bibles the pysword python module must be installed. Please read the manual for instructions.Om de SWORD bijbels te importeren, moet de pysword pytjon module worden geïnstalleerd. Lees de handleiding voor instructies.License DetailsLicentiedetailsSet up the Bible's license details.Geef aan welke licentievoorwaarden gelden voor deze bijbelvertaling.Version name:Versie naam:Copyright:Copyright:Permissions:Rechten:Full license:Please wait while your Bible is imported.Een moment geduld. De bijbelvertaling wordt geïmporteerd.You need to specify a file with books of the Bible to use in the import.Er moet een bestand met beschikbare bijbelboeken opgegeven worden.You need to specify a file of Bible verses to import.Er moet een bestand met bijbelverzen opgegeven worden.You need to specify a version name for your Bible.U moet een naam opgeven voor deze versie van de bijbel.You need to set a copyright for your Bible. Bibles in the Public Domain need to be marked as such.U moet opgeven welke copyrights gelden voor deze bijbelvertaling. Bijbels in het publieke domein moeten als zodanig gemarkeerd worden.Bible ExistsBijbel bestaat alThis Bible already exists. Please import a different Bible or first delete the existing one.Deze bijbelvertaling bestaat reeds. Importeer een andere vertaling of verwijder eerst de bestaande versie.Error during downloadFout tijdens het downloadenAn error occurred while downloading the list of bibles from %s.Er is een fout opgetreden bij het downloaden van de bijbellijst van %s.Registering Bible...Bezig met registreren van bijbel...Registered Bible. Please note, that verses will be downloaded on demand and thus an internet connection is required.Bijbel geregistreerd. Let op, de bijbelverzen worden gedownload
indien nodig en een internetverbinding is dus noodzakelijk.Your Bible import failed.Het importeren is mislukt.BiblesPlugin.LanguageDialogSelect LanguageSelecteer taalOpenLP is unable to determine the language of this translation of the Bible. Please select the language from the list below.OpenLP kan niet bepalen in welke taal deze Bijbel is geschreven. Selecteer een taal uit de onderstaande lijst.Language:Taal:BiblesPlugin.LanguageFormYou need to choose a language.Geef een taal op.BiblesPlugin.MediaItemFindFind:Vind:SelectSelecteerSort bible books alphabetically.Book:Boek:From:Van:To:Tot:OptionsOptiesSecond:Tweede:Chapter:Hoofdstuk:Verse:Vers:Clear the results on the current tab.Add the search results to the saved list.Text or ReferenceTekst of referentieText or Reference...Tekst of referentie...Scripture ReferenceSchriftverwijzingSearch Scripture Reference...Zoek schriftverwijzingText SearchZoek in tekstSearch Text...Zoek tekst...Are you sure you want to completely delete "{bible}" Bible from OpenLP?
You will need to re-import this Bible to use it again.Saved ({result_count})Results ({result_count})OpenLP cannot combine single and dual Bible verse search results. Do you want to clear your saved results?Bible not fully loaded.Bijbel niet geheel geladen.Verses not foundThe second Bible "{second_name}" does not contain all the verses that are in the main Bible "{name}".
Only verses found in both Bibles will be shown.
{count:d} verses have not been included in the results.BiblesPlugin.OsisImportRemoving unused tags (this may take a few minutes)...Ongebruikte tags verwijderen (dit kan enkele minuten duren)...Importing {book} {chapter}...Importeren {book} {chapter}...BiblesPlugin.SwordImporting {name}...Importeren {name}...BiblesPlugin.SwordImportAn unexpected error happened while importing the SWORD bible, please report this to the OpenLP developers.
{error}BiblesPlugin.WordProjectBibleIncorrect Bible file type, not a Zip file.Incorrect Bible file type, files are missing.BiblesPlugin.ZefaniaImportIncorrect Bible file type. Expected data is missing.Incorrect Bible file type supplied. Zefania Bibles may be compressed. You must decompress them before import.Incorrect bijbelbestand. Zefania bijbels kunnen gecomprimeerd zijn en moeten uitgepakt worden vóór het importeren.BiblesPlugin.ZefniaImporting {book} {chapter}...Importeren {book} {chapter}...CustomPlugin<strong>Custom Slide Plugin</strong><br />The custom slide plugin provides the ability to set up custom text slides that can be displayed on the screen the same way songs are. This plugin provides greater freedom over the songs plugin.<strong>Custom plug-in</strong><br />De custom plug-in voorziet in mogelijkheden om aangepaste tekst weer te geven op dezelfde manier als liederen. Deze plug-in voorziet in meer mogelijkheden dan de Lied plug-in.Custom Slidename singularAangepaste diaCustom Slidesname pluralAangepaste dia’sCustom Slidescontainer titleAangepaste dia’sLoad a new custom slide.Aangepaste dia laden.Import a custom slide.Aangepaste dia importeren.Add a new custom slide.Aangepaste dia toevoegen.Edit the selected custom slide.Geselecteerde dia bewerken.Delete the selected custom slide.Geselecteerde dia verwijderen.Preview the selected custom slide.Voorbeeld van geselecteerde dia bekijken.Send the selected custom slide live.Toon geselecteerde dia live.Add the selected custom slide to the service.Geselecteerde dia aan liturgie toevoegen.CustomPlugin.CustomTabCustom DisplayAangepaste weergaveDisplay footerVoettekst weergevenImport missing custom slides from service filesImporteer ontbrekende aangepaste dia's uit liturgiebestandCustomPlugin.EditCustomFormEdit Custom SlidesAangepaste dia's bewerken&Title:&Titel:Add a new slide at bottom.Nieuwe dia onderaan toevoegen.Edit the selected slide.Geselecteerde dia bewerken.Ed&it All&Alles bewerkenEdit all the slides at once.Alle dia's tegelijk bewerken.The&me:The&ma:&Credits:&Auteur:You need to type in a title.Geef een titel op.You need to add at least one slide.Voeg minimaal één dia toe.Insert SlideDia invoegenSplit a slide into two by inserting a slide splitter.Dia splitsen door een dia 'splitter' in te voegen.CustomPlugin.EditVerseFormEdit SlideDia bewerkenCustomPlugin.MediaItemAre you sure you want to delete the "{items:d}" selected custom slide(s)?copyFor item cloningkopieerImagePlugin<strong>Image Plugin</strong><br />The image plugin provides displaying of images.<br />One of the distinguishing features of this plugin is the ability to group a number of images together in the service manager, making the displaying of multiple images easier. This plugin can also make use of OpenLP's "timed looping" feature to create a slide show that runs automatically. In addition to this, images from the plugin can be used to override the current theme's background, which renders text-based items like songs with the selected image as a background instead of the background provided by the theme.<strong>Afbeeldingen plug-in</strong><br />De afbeeldingen plug-in voorziet in de mogelijkheid afbeeldingen te laten zien.<br />Een van de bijzondere mogelijkheden is dat meerdere afbeeldingen als groep in de liturgie worden opgenomen, zodat weergave van meerdere afbeeldingen eenvoudiger wordt. Deze plug-in maakt doorlopende diashows (bijv. om de 3 sec. een nieuwe dia) mogelijk. Ook kun met deze plug-in de achtergrondafbeelding van het thema vervangen met een andere afbeelding. Ook de combinatie van tekst en beeld is mogelijk.Imagename singularAfbeeldingImagesname pluralAfbeeldingenImagescontainer titleAfbeeldingenAdd new image(s).Nieuwe afbeelding(en) toevoegen.Add a new image.Nieuwe afbeelding toevoegen.Edit the selected image.Geselecteerde afbeelding bewerken.Delete the selected image.Geselecteerde afbeelding verwijderen.Preview the selected image.Voorbeeld van geselecteerde afbeelding bekijken.Send the selected image live.Geselecteerde afbeelding live tonen.Add the selected image to the service.Geselecteerde afbeelding aan liturgie toevoegen.Add new image(s)Nieuwe afbeelding(en) toevoegen.ImagePlugin.AddGroupFormAdd groupVoeg groep toeParent group:Bovenliggende groepGroup name:Groepsnaam:You need to type in a group name.U moet een groepsnaam invullen.Could not add the new group.Kon de nieuwe groep niet toevoegen.This group already exists.Deze groep bestaat al.ImagePlugin.ChooseGroupFormSelect Image GroupSelecteer afbeelding groepAdd images to group:Voeg afbeeldingen toe aan groep:No groupGeen groepExisting groupBestaande groepNew groupNieuwe groepImagePlugin.ExceptionDialogSelect AttachmentSelecteer bijlageImagePlugin.MediaItem-- Top-level group ---- Hoogste niveau groep --Select Image(s)Selecteer afbeelding(en)You must select an image or group to delete.Selecteer een afbeelding of groep om te verwijderen.Remove groupVerwijder groepAre you sure you want to remove "{name}" and everything in it?Missing Image(s)Ontbrekende afbeelding(en)The following image(s) no longer exist: {names}The following image(s) no longer exist: {names}
Do you want to add the other images anyway?You must select an image to replace the background with.Selecteer een afbeelding om de achtergrond te vervangen.There was a problem replacing your background, the image file "{name}" no longer exists.ImagesPlugin.ImageTabVisible background for images with aspect ratio different to screen.Zichtbare achtergrond voor afbeeldingen met een andere verhouding dan het scherm.MediaPlugin<strong>Media Plugin</strong><br />The media plugin provides playback of audio and video.<strong>Media plug-in</strong><br />De media plug-in voorziet in de mogelijkheid om audio en video af te spelen.Medianame singularMediaMedianame pluralMediaMediacontainer titleMediaLoad new media.Nieuwe media laden.Add new media.Nieuwe media toevoegen.Edit the selected media.Geselecteerd mediabestand bewerken.Delete the selected media.Geselecteerd mediabestand verwijderen.Preview the selected media.Toon voorbeeld van geselecteerd mediabestand.Send the selected media live.Geselecteerd mediabestand live tonen.Add the selected media to the service.Geselecteerd mediabestand aan liturgie toevoegen.MediaPlugin.MediaClipSelectorSelect Media ClipSelecteer fragmentSourceBronMedia path:Media pad:Select drive from listSelecteer de speler uit de lijstLoad discSchijf ladenTrack DetailsTrackdetailsTitle:Titel:Audio track:Geluidsspoor:Subtitle track:Ondertiteling:HH:mm:ss.zHH:mm:ss.zClip RangeFragmentdetailsStart point:Startpunt:Set start pointStartpunt instellenJump to start pointSpring naar startpuntEnd point:Eindpunt:Set end pointEindpunt instellenJump to end pointSpring naar eindpuntMediaPlugin.MediaClipSelectorFormNo path was givenEr is geen pad opgegevenGiven path does not existAn error happened during initialization of VLC playerEr is een fout opgetreden bij het initialiseren van VLCVLC player failed playing the mediaVLC kon de schijf niet afspelenCD not loaded correctlyCD niet correct geladenThe CD was not loaded correctly, please re-load and try again.De CD is niet correct geladen. Probeer het alstublieft nogmaals.DVD not loaded correctlyDVD niet correct geladenThe DVD was not loaded correctly, please re-load and try again.De DVD is niet correct geladen. Probeer het alstublieft nogmaals.Set name of mediaclipNaam van het fragment instellenName of mediaclip:Naam van het fragment:Enter a valid name or cancelVoer een geldige naam in of klik op AnnulerenInvalid characterOngeldig tekenThe name of the mediaclip must not contain the character ":"De naam van het fragment mag het teken ":" niet bevattenMediaPlugin.MediaItemVLC is not availableDevice streaming support requires VLC.Network streaming support requires VLC.Unsupported FileBestandsformaat wordt niet ondersteundSelect MediaSelecteer mediabestandLoad CD/DVDCD/DVD ladenOpen device streamOpen network streamMissing Media FileOntbrekend mediabestandThe optical disc {name} is no longer available.The file {name} no longer exists.Videos ({video});;Audio ({audio});;{files} (*)You must select a media file to delete.Selecteer een mediabestand om te verwijderen.Optical device support requires VLC.Mediaclip already savedFragment was al opgeslagenThis mediaclip has already been savedDit fragment was al opgeslagenStream already savedThis stream has already been savedMediaPlugin.MediaTabLive MediaVLC arguments (requires restart)Start Live items automaticallyStart Live items automatischMediaPlugin.StreamSelectorA Stream name is needed.A MRL is needed.More optionsCachingMRLVLC optionsInsert Input StreamStream nameNetwork URLDevice SelectionOptionsOptiesVideo device nameAudio device nameVideo standardFrequencyTuner cardDelivery systemTransponder/multiplexer frequencyBandwidthModulation / ConstellationTransponder symbol rateUse VLC paceAuto connectionSelected portsChannelsVideo sizeDirectShowVideo CameraTV - analogJACK Audio Connection KitTV - digitalInput devicesSelect Input StreamCapture ModeMediaPlugin.VlcPlayerThe VLC arguments are invalid.OpenLPData Directory ErrorBestandslocatie foutOpenLP data folder was not found in:
{path}
The location of the data folder was previously changed from the OpenLP's default location. If the data was stored on removable device, that device needs to be made available.
You may reset the data location back to the default location, or you can try to make the current location available.
Do you want to reset to the default data location? If not, OpenLP will be closed so you can try to fix the problem.BackupBackupOpenLP has been upgraded, do you want to create
a backup of the old data folder?Backup of the data folder failed!Backup van de datamap is mislukt!A backup of the data folder has been created at:
{text}Settings UpgradeYour settings are about to be upgraded. A backup will be created at {back_up_path}Settings back up failed.
Continuing to upgrade.Image FilesAfbeeldingsbestandenVideo FilesVideobestandenOpenOpenOpenLP.APITabAPIOpenLP.AboutForm<p>OpenLP {{version}}{{revision}} - Open Source Lyrics Projection<br>Copyright {crs} 2004-{yr} OpenLP Developers</p><p>Find out more about OpenLP: <a href="https://openlp.org/">https://openlp.org/</a></p><p>This program is free software: you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later version.</p><p>This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details.</p><p>You should have received a copy of the GNU General Public License along with this program. If not, see <a href="https://www.gnu.org/licenses/">https://www.gnu.org/licenses/</a>.</p>OpenLP is written and maintained by volunteers all over the world in their spare time. If you would like to see this project succeed, please consider contributing to it by clicking the "contribute" button below.OpenLP would not be possible without the following software libraries:<h3>Final credit:</h3><blockquote><p>For God so loved the world that He gave His one and only Son, so that whoever believes in Him will not perish but inherit eternal life.</p><p>John 3:16</p></blockquote><p>And last but not least, final credit goes to God our Father, for sending His Son to die on the cross, setting us free from sin. We bring this software to you for free because He has set us free.</p>CreditsCreditsLicenseLicentieContributeBijdragen build {version} build {version}OpenLP.AdvancedTabAdvancedGeavanceerdUI SettingsProgramma instellingenData LocationBestandslocatieNumber of recent service files to display:Open the last used Library tab on startupDouble-click to send items straight to LivePreview items when clicked in LibraryPreview items when clicked in ServiceExpand new service items on creationNieuwe liturgieonderdelen automatisch uitklappenMax height for non-text slides
in slide controller:Max hoogte voor niet-tekst dia's
in dia bediener:DisabledUitgeschakeldAutomaticAutomatischWhen changing slides:Bij wijzigen dia's:Do not auto-scrollGeen auto-scrollAuto-scroll the previous slide into viewAuto-scroll vorige dia in beeldAuto-scroll the previous slide to topAuto-scroll bovenaanAuto-scroll the previous slide to middleAuto-scroll voorgaande dia naar het middenAuto-scroll the current slide into viewAuto-scroll huidige dia in beeldAuto-scroll the current slide to topAuto-scroll huidige dia tot bovenaanAuto-scroll the current slide to middleAuto-scroll huidige dia naar het middenAuto-scroll the current slide to bottomAuto-scroll huidige dia tot onderaanAuto-scroll the next slide into viewAuto-scroll volgende dia in beeldAuto-scroll the next slide to topAuto-scroll volgende dia tot bovenaanAuto-scroll the next slide to middleAuto-scroll volgende dia naar het middenAuto-scroll the next slide to bottomAuto-scroll volgende dia tot onderaanEnable application exit confirmationAfsluiten OpenLP bevestigenUse dark style (needs restart)Default Service NameStandaard liturgienaamEnable default service nameGebruik standaard liturgienaamDate and Time:Datum en tijd:MondaymaandagTuesdaydinsdagWednesdaywoensdagThursdayDonderdagFridayvrijdagSaturdayzaterdagSundayzondagNowNuTime when usual service starts.Begintijd gewone dienstName:Naam:Consult the OpenLP manual for usage.Raadpleeg de OpenLP handleiding voor gebruik.Revert to the default service name "{name}".Example:Voorbeeld:Hide mouse cursor when over display windowVerberg muisaanwijzer in het weergavevensterPath:CancelAnnuleerCancel OpenLP data directory location change.Annuleer OpenLP bestandslocatie wijziging.Copy data to new location.Kopieer data naar de nieuwe bestandslocatie.Copy the OpenLP data files to the new location.Kopieer OpenLP data naar de nieuwe bestandslocatie.<strong>WARNING:</strong> New data directory location contains OpenLP data files. These files WILL be replaced during a copy.<strong>LET OP:</strong> In de nieuwe bestandslocatie staan al OpenLP data bestanden. Die bestanden worden vervangen tijdens kopieren.Display WorkaroundsWeergeven omwegenIgnore Aspect RatioBypass X11 Window ManagerNegeer X11 Window ManagerUse alternating row colours in listsGebruik wisselende rijkleuren in lijstenDisable display transparencySyntax error.Syntax fout.Confirm Data Directory ChangeBevestig wijziging bestandslocatieAre you sure you want to change the location of the OpenLP data directory to:
{path}
The data directory will be changed when OpenLP is closed.Overwrite Existing DataOverschrijf bestaande dataRestart RequiredHerstarten vereistThis change will only take effect once OpenLP has been restarted.Deze wijziging werkt pas nadat OpenLP opnieuw is gestart.Select Logo FileOpenLP.ColorButtonClick to select a color.Klik om een kleur te kiezen.OpenLP.DBRGBRGBVideoVideoDigitalDigitaalStorageOpslagNetworkNetwerkInternal123456789ABCDEFGHIJKLMNOPQRSTUVVWXXYYZOpenLP.DisplayWindowDisplay WindowOpenLP.ExceptionDialogError OccurredFout<strong>Please describe what you were trying to do.</strong> If possible, write in English.<strong>Oops, OpenLP hit a problem and couldn't recover!<br><br>You can help </strong> the OpenLP developers to <strong>fix this</strong> by<br> sending them a <strong>bug report to {email}</strong>{newlines}{first_part}<strong>No email app? </strong> You can <strong>save</strong> this information to a <strong>file</strong> and<br>send it from your <strong>mail on browser</strong> via an <strong>attachment.</strong><br><br><strong>Thank you</strong> for being part of making OpenLP better!<br>Send E-MailStuur e-mailSave to FileOpslaan als bestandAttach FileVoeg bestand toeFailed to Save ReportThe following error occurred when saving the report.
{exception}<strong>Thank you for your description!</strong><strong>Tell us what you were doing when this happened.</strong><strong>Please enter a more detailed description of the situation</strong>OpenLP.ExceptionFormPlatform: {platform}
Platform: {platform}
Save Crash ReportCrash rapport opslaanText files (*.txt *.log *.text)Tekstbestand (*.txt *.log *.text)OpenLP.FileRenameFormNew File Name:Nieuwe bestandsnaam:File CopyBestand kopiërenFile RenameBestand hernoemenOpenLP.FirstTimeLanguageFormSelect TranslationSelecteer taalChoose the translation you'd like to use in OpenLP.Kies de taal waarin u OpenLP wilt gebruiken.Translation:Taal:OpenLP.FirstTimeWizardNetwork ErrorNetwerkfoutThere was a network error attempting to connect to retrieve initial configuration informationEr is een netwerkfout opgetreden tijdens het ophalen van de standaardinstellingenDownloading {name}...Downloaden {name}...Invalid index fileOpenLP was unable to read the resource index file. Please try again later.Download ErrorDownloadfoutThere was a connection problem during download, so further downloads will be skipped. Try to re-run the First Time Wizard later.Er is een verbindingsprobleem opgetreden tijdens het downloaden. Volgende downloads zullen overgeslagen worden. Probeer alstublieft de Eerste Keer Assistent later nogmaals te starten.Setting Up And DownloadingInstellen en downloadenPlease wait while OpenLP is set up and your data is downloaded.Een moment geduld terwijl OpenLP ingesteld wordt en de voorbeeldgegevens worden gedownload.Setting UpInstellenDownload complete. Click the '{finish_button}' button to return to OpenLP.Download complete. Click the '{finish_button}' button to start OpenLP.Click the '{finish_button}' button to return to OpenLP.Click the '{finish_button}' button to start OpenLP.There was a connection problem while downloading, so further downloads will be skipped. Try to re-run the First Time Wizard later.Er is een verbindingsprobleem opgetreden tijdens het downloaden. Volgende downloads zullen overgeslagen worden. Probeer alstublieft de Eerste Keer Assistent later nogmaals te starten.Unable to download some filesKon sommige bestanden niet downloadenOpenLP has a web remote, which enables you to control OpenLP from another computer, phone or tablet on the same network as the OpenLP computer. OpenLP can download this web remote for you now, or you can download it later via the remote settings.Yes, download the remote nowWeb-based Remote InterfacePlease confirm if you want to download the web remote.First Time WizardEerste Keer AssistentWelcome to the First Time WizardWelkom bij de Eerste Keer AssistentThis wizard will help you to configure OpenLP for initial use. Click the '{next_button}' button below to start.Internet SettingsDownloading Resource IndexBezig met downloaden van bronindexPlease wait while the resource index is downloaded.Een moment geduld. De bronindex wordt gedownload.Please wait while OpenLP downloads the resource index file...Een moment geduld. OpenLP downloadt de bronindex...Select parts of the program you wish to useSelecteer de programmadelen die u wilt gebruikenYou can also change these settings after the Wizard.U kunt deze instellingen ook wijzigen na de Assistent.DisplaysChoose the main display screen for OpenLP.SongsLiederenCustom Slides – Easier to manage than songs and they have their own list of slidesMaatwerkdia's - Eenvoudiger te beheren dan liederen en ze hebben eigen lijsten met dia'sBibles – Import and show BiblesBijbels – Importeer en toon bijbelsImages – Show images or replace background with themAfbeeldingen – Tonen afbeeldingen of achtergrond erdoor vervangenPresentations – Show .ppt, .odp and .pdf filesPresentaties – Tonen .ppt, .odp en .pdf bestandenMedia – Playback of Audio and Video filesMedia – Afspelen van Audio en Video bestandenSong Usage MonitorSong gebruiksmonitorAlerts – Display informative messages while showing other slidesWaarschuwingen – Tonen informatieve berichten tijdens tonen andere dia'sResource DataCan OpenLP download some resource data?OpenLP has collected some resources that we have permission to distribute.
If you would like to download some of these resources click the '{next_button}' button, otherwise click the '{finish_button}' button.No Internet ConnectionGeen internetverbindingCannot connect to the internet.OpenLP could not connect to the internet to get information about the sample data available.
Please check your internet connection. If your church uses a proxy server click the 'Internet Settings' button below and enter the server details there.
Click the '{back_button}' button to try again.
If you click the '{finish_button}' button you can download the data at a later time by selecting 'Re-run First Time Wizard' from the 'Tools' menu in OpenLP.Sample SongsVoorbeeldliederenSelect and download public domain songs.Selecteer en download liederen uit het publieke domein.Sample BiblesVoorbeeldbijbelsSelect and download free Bibles.Selecteer en download (gratis) bijbels uit het publieke domein.Sample ThemesVoorbeeldthema'sSelect and download sample themes.Selecteer en download voorbeeldthema's.Default theme:Select allDeselect allDownloading and ConfiguringBezig met downloaden en instellenPlease wait while resources are downloaded and OpenLP is configured.Een moment geduld. De bronnen worden gedownload en OpenLP wordt ingesteld.OpenLP.FontSelectWidgetFont:Lettertype:Color:Kleur:Style:BoldVetItalicCursiefSize:Grootte:Line Spacing:Interlinie:OutlineShadowOpenLP.FormattingTagDialogConfigure Formatting TagsConfigureer opmaaktagsDefault FormattingStandaard opmaakDescriptionOmschrijvingTagTagStart HTMLStart HTMLEnd HTMLEind HTMLCustom FormattingAangepaste opmaakOpenLP.FormattingTagFormTag {tag} already defined.Description {tag} already defined.Start tag {tag} is not valid HTMLEnd tag {end} does not match end tag for start tag {start}New Tag {row:d}Nieuwe tag {row:d}<HTML here><HTML hier>Validation ErrorValidatie foutDescription is missingOmschrijving ontbreektTag is missingTag ontbreektOpenLP.FormattingTagsRedRoodBlackZwartBlueBlauwYellowGeelGreenGroenPinkRozeOrangeOranjePurplePaarsWhiteWitSuperscriptSuperscriptSubscriptSubscriptParagraphParagraafBoldVetItalicsCursiefUnderlineOnderstreeptBreakBreek af OpenLP.GeneralTabService Item Slide LimitsDia navigatie beperkingenBehavior of next/previous on the last/first slide:Gedrag van volgende/vorige op de laatste en eerste dia:&Remain on Slide&Blijf op dia &Wrap around&Verder aan begin/eind&Move to next/previous service item&Naar het volgende/volgende liturgieonderdeelGeneralAlgemeenApplication StartupProgramma startShow blank screen warningToon leeg scherm waarschuwingAutomatically open the previous service fileShow the splash screenToon splash screenLogoLogoLogo file:Logo bestand:Don't show logo on startupToon geen logo bij opstartenCheck for updates to OpenLPControleer op updates voor OpenLPApplication SettingsProgramma instellingenUnblank display when changing slide in LiveUnblank display when sending items to LiveAutomatically preview the next item in serviceTimed slide interval:Tijd tussen dia’s: sec secCCLI DetailsCCLI-detailsSongSelect username:SongSelect gebruikersnaam:SongSelect password:SongSelect wachtwoord:OpenLP.LanguageManagerLanguageTaalPlease restart OpenLP to use your new language setting.Start OpenLP opnieuw op om de nieuwe taalinstellingen te gebruiken.OpenLP.MainWindowEnglishPlease add the name of your language hereDutchGeneralAlgemeen&File&Bestand&Import&Importeren&Export&Exporteren&Recent Services&Recente liturgiën&View&Weergave&Layout Presets&Layout instellingen&Tools&Hulpmiddelen&Settings&Instellingen&LanguageTaa&l&Help&HelpLibraryBibliotheekServiceLiturgieThemesThema'sProjector Controller&New Service&Nieuwe liturgie&Open Service&Open liturgieOpen an existing service.Open een bestaande liturgie.&Save ServiceLiturgie op&slaanSave the current service to disk.De huidige liturgie opslaan.Save Service &As...Liturgie opslaan &als...Save Service AsLiturgie opslaan alsSave the current service under a new name.Deze liturgie onder een andere naam opslaan.Print the current service.De huidige liturgie afdrukken.E&xit&AfsluitenClose OpenLP - Shut down the program.&Theme&ThemaConfigure &Shortcuts...&Sneltoetsen instellen...Configure &Formatting Tags...Configureer &opmaak tags...&Configure OpenLP...&Instellingen...Export settings to a *.config file.SettingsInstellingenImport settings from a *.config file previously exported from this or another machine.&Projector ControllerHide or show Projectors.Toggle visibility of the Projectors.L&ibraryB&ibliotheekHide or show the Library.Toggle the visibility of the Library.&Themes&Thema'sHide or show themesToggle visibility of the Themes.&Service&DienstHide or show Service.Verberg of toon dienstToggle visibility of the Service.&Preview&VoorbeeldHide or show Preview.Toggle visibility of the Preview.Li&veLi&veHide or show LiveL&ock visibility of the panelsLock visibility of the panels.Toggle visibility of the Live.&Manage PluginsPlug-ins beherenYou can enable and disable plugins from here.&About&Over OpenLPMore information about OpenLP.&User ManualGebr&uikshandleidingJump to the search box of the current active plugin.Ga naar het zoekveld van de momenteel actieve plugin.&Web Site&WebsiteSet the interface language to {name}&Autodetect&AutodetecteerUse the system language, if available.Gebruik standaardtaal van het systeem, indien mogelijk.Add &Tool...Hulpprogramma &toevoegen...Add an application to the list of tools.Voeg een hulpprogramma toe aan de lijst.Open &Data Folder...Open &datamap...Open the folder where songs, bibles and other data resides.Open de map waar liederen, bijbels en andere data staat.Re-run First Time WizardHerstart Eerste Keer AssistentRe-run the First Time Wizard, importing songs, Bibles and themes.Herstart Eerste Keer Assistent, importeer voorbeeldliederen, bijbels en thema’s.Update Theme ImagesThema afbeeldingen bijwerkenUpdate the preview images for all themes.Voorbeeldafbeeldingen bijwerken voor alle thema’s.&Show all&Toon allesReset the interface back to the default layout and show all the panels.&Setup&VoorbereidingUse layout that focuses on setting up the Service.&Live&LiveUse layout that focuses on Live.Waiting for some things to finish...Please WaitVersion {new} of OpenLP is now available for download (you are currently running version {current}).
You can download the latest version from https://openlp.org/.OpenLP Version UpdatedNieuwe OpenLP versie beschikbaarVersion {version} of the web remote is now available for download.
To download this version, go to the Remote settings and click the Upgrade button.New Web Remote Version AvailableRe-run First Time Wizard?Herstart Eerste Keer Assistent?Are you sure you want to re-run the First Time Wizard?
Re-running this wizard may make changes to your current OpenLP configuration and possibly add songs to your existing songs list and change your default theme.Weet u zeker dat u de Eerste Keer Assistent opnieuw wilt starten?
De Eerste Keer Assistent opnieuw starten zou veranderingen in uw huidige OpenLP instellingen kunnen maken en mogelijk liederen aan uw huidige lijst kunnen toevoegen en uw standaardthema wijzigen.OpenLP Main Display BlankedOpenLP projectie uitgeschakeldThe Main Display has been blanked outProjectie is uitgeschakeld: scherm staat op zwartImport settings?Importeer instellingen?Are you sure you want to import settings?
Importing settings will make permanent changes to your current OpenLP configuration.
Importing incorrect settings may cause erratic behaviour or OpenLP to terminate abnormally.Weet u zeker dat u instellingen wilt importeren?
Instellingen importeren zal uw huidige OpenLP configuratie veranderen.
Incorrecte instellingen importeren veroorzaakt onvoorspelbare effecten of OpenLP kan spontaan stoppen.Import settingsImporteer instellingenOpenLP Settings (*.conf)OpenLP instellingen (*.conf)The file you have selected does not appear to be a valid OpenLP settings file.
Processing has terminated and no changes have been made.Het geslecteerde bestand is geen geldig OpenLP settings bestand.
Verwerking is gestopt en er is niets veranderd.OpenLP will now close. Imported settings will be applied the next time you start OpenLP.OpenLP sluit nu af. De geïmporteeerde instellingen worden bij de volgende start van OpenLP toegepast.Export Settings FileExporteer instellingenExport setting errorExportfoutAn error occurred while exporting the settings: {err}Er trad een fout op bij het exporteren van de instellingen: {err}Screen setup has changedThe screen setup has changed. OpenLP will try to automatically select a display screen, but you should consider updating the screen settings.Exit OpenLPOpenLP afsluitenAre you sure you want to exit OpenLP?OpenLP afsluiten?&Exit OpenLPOpenLP afsluit&enDefault Theme: {theme}Standaard thema: {theme}Clear ListClear List of recent filesLijst leegmakenClear the list of recent files.Maak de lijst met recente bestanden leeg.Copying OpenLP data to new data directory location - {path} - Please wait for copy to finishOpenLP data wordt nu naar de nieuwe datadirectory locatie gekopieerd - {path} - Een moment geduld alstublieftOpenLP Data directory copy failed
{err}OpenLP data directory kopiëren is mislukt
{err}New Data Directory ErrorNieuwe bestandslocatie foutOpenLP.ManagerDatabase ErrorDatabase foutOpenLP cannot load your database.
Database: {db}The database being loaded was created in a more recent version of OpenLP. The database is version {db_ver}, while OpenLP expects version {db_up}. The database will not be loaded.
Database: {db_name}OpenLP.MediaControllerOpenLP requires the following libraries in order to show videos and other media, but they are not installed. Please install these libraries to enable media playback in OpenLP.To install these libraries, you will need to enable the RPMFusion repository: https://rpmfusion.org/macOS is missing VLC. Please download and install from the VLC web site: https://www.videolan.org/vlc/No Displays have been configured, so Live Media has been disabledOpenLP.MediaManagerItemNo Items SelectedGeen items geselecteerd&Add to selected Service Item&Voeg toe aan geselecteerde liturgie-itemInvalid File TypeOngeldig bestandsformaatInvalid File {file_path}.
File extension not supportedDuplicate files were found on import and were ignored.Identieke bestanden die bij het importeren zijn gevonden worden genegeerd.You must select one or more items to preview.Selecteer een of meerdere onderdelen om als voorbeeld te laten zien.You must select one or more items to send live.Selecteer een of meerdere onderdelen om live te tonen.You must select one or more items to add.Selecteer een of meerdere onderdelen om toe te voegen.You must select one or more items.Selecteer een of meerdere onderdelen.You must select an existing service item to add to.Selecteer een liturgie om deze onderdelen aan toe te voegen.Invalid Service ItemOngeldigl liturgie-onderdeelYou must select a {title} service item.&Clone&KloonOpenLP.MediaTabMediaMediaOpenLP.OpenLyricsImportError<lyrics> tag is missing.<lyrics> tag niet gevonden.<verse> tag is missing.<verse> tag niet gevonden.OpenLP.PJLinkFanVentilatorLampLampTemperatureTemperatuurCoverKlepFilterFilterNo messageGeen berichtError while sending data to projectorFout tijdens het zenden van data naar de projectorOpenLP.PJLinkConstantsAcknowledge a PJLink SRCH command - returns MAC address.Blank/unblank video and/or mute audio.Query projector PJLink class support.Query error status from projector. Returns fan/lamp/temp/cover/filter/other error status.Query number of hours on filter.Freeze or unfreeze current image being projected.Query projector manufacturer name.Query projector product name.Query projector for other information set by manufacturer.Query specified input source nameSwitch to specified video source.Query available input sources.Query current input resolution.Query lamp time and on/off status. Multiple lamps supported.UDP Status - Projector is now available on network. Includes MAC address.Adjust microphone volume by 1 step.Query customer-set projector name.Initial connection with authentication/no authentication request.Turn lamp on or off/standby.Query replacement air filter model number.Query replacement lamp model number.Query recommended resolution.Query projector serial number.UDP broadcast search request for available projectors. Reply is ACKN.Query projector software version number.Adjust speaker volume by 1 step.OpenLP.PathEditBrowse for directory.Revert to default directory.Browse for file.Revert to default file.Select DirectorySelecteer mapSelect FileOpenLP.PluginFormManage PluginsPlug-ins beherenPlugin DetailsPlug-in detailsStatus:Status:ActiveActief{name} (Disabled){name} (Disabled){name} (Active){name} (Active){name} (Inactive){name} (Inactive)OpenLP.PluginManagerUnable to initialise the following plugins:See the log file for more detailsOpenLP.PrintServiceDialogFit PagePassend maken op de paginaFit WidthAanpassen aan pagina breedteOpenLP.PrintServiceFormPrintAfdrukkenCopy as TextCopy as HTMLKopieer als HTMLZoom OutUitzoomenZoom OriginalWerkelijke grootteZoom InInzoomenOptionsOptiesTitle:Titel:Service Note Text:Other OptionsOverige optiesInclude slide text if availableInclusief diatekst indien beschikbaarAdd page break before each text itemVoeg een pagina-einde toe voor elk tekst itemInclude service item notesInclusief liturgie-opmerkingenInclude play length of media itemsInclusief afspeellengte van media itemsShow chordsService SheetLiturgie bladOpenLP.ProjectorConstantsThe address specified with socket.bind() is already in use and was set to be exclusiveHet adres gebruikt in socket.bind() is al in gebruik en is ingesteld als exclusiefPJLink returned "ERRA: Authentication Error"The connection was refused by the peer (or timed out)De verbinding is geweigerd of misluktProjector cover open detectedPJLink class not supportedPJLink klasse wordt niet ondersteundThe datagram was larger than the operating system's limitHet datagram was groter dan de limiet van het besturingssysteemError condition detectedFoutsituatie gedetecteerdProjector fan errorProjector check filterGeneral projector errorAlgemene projectorfoutThe host address was not foundHet adres is niet gevondenPJLink invalid packet receivedProjector lamp errorAn error occurred with the network (Possibly someone pulled the plug?)Er is een netwerkfout opgetreden (is de kabel ontkoppeld?)PJLink authentication Mismatch ErrorProjector not connected errorPJLink returned "ERR2: Invalid Parameter"PJLink Invalid prefix characterPJLink returned "ERR4: Projector/Display Error"The socket is using a proxy, and the proxy requires authenticationDe socket gebruikt een proxy waarvoor authenticatie nodig isThe connection to the proxy server was closed unexpectedly (before the connection to the final peer was established)De verbinding met de proxyserver is onverwachts verbroken (voordat de uiteindelijke verbinding tot stand gekomen is)Could not contact the proxy server because the connection to that server was deniedDe verbinding met de proxyserver is geweigerdThe connection to the proxy server timed out or the proxy server stopped responding in the authentication phase.De verbinding met de proxyserver is verlopen of de proxyserver heeft geen antwoord gegeven in de authenticatiefase.The proxy address set with setProxy() was not foundHet proxyserveradres meegegeven aan setProxy() is niet gevondenThe connection negotiation with the proxy server failed because the response from the proxy server could not be understoodDe verbinding met de proxyserver is mislukt doordat de antwoorden van de proxyserver niet herkend wordenThe remote host closed the connectionDe externe host heeft de verbinding verbrokenThe SSL/TLS handshake failedDe SSL/TLS handshake is misluktThe address specified to socket.bind() does not belong to the hostHet adres gebruikt in socket.bind() bestaat niet op de computerThe socket operation failed because the application lacked the required privilegesDe socketbewerking is mislukt doordat het programma de vereiste privileges mistThe local system ran out of resources (e.g., too many sockets)Het lokale systeem heeft te weinig bronnen beschikbaarThe socket operation timed outDe socketbewerking is gestopt door een time-outProjector high temperature detectedPJLink returned "ERR3: Busy"PJLink returned "ERR1: Undefined Command"The last operation attempted has not finished yet (still in progress in the background)De vorige bewerking is nog niet afgerond (loopt door in de achtergrond)Unknown condition detectedAn unidentified socket error occurredThe requested socket operation is not supported by the local operating system (e.g., lack of IPv6 support)De socketbewerking wordt niet ondersteund door het besturingssysteem (bijvoorbeeld als IPv6-ondersteuning mist)Warning condition detectedWaarschuwingssituatie gedetecteerdConnection initializing with pinSocket is bound to an address or portConnection initializingSocket is about to closeConnectedVerbondenConnectingVerbinding makenCooldown in progressAfkoelen bezigCommand returned with OKPerforming a host name lookupProjector Information availableProjectorinformatie beschikbaarInitialize in progressInitialisatie bezigSocket is listening (internal use only)No network activity at this timeReceived dataGegevens ontvangenSending dataGegevens versturenNot ConnectedOffUitOKOKPower is onIngeschakeldPower in standbyStandbyGetting statusStatus opvragenWarmup in progressOpwarmen bezigOpenLP.ProjectorEditName Not SetNaam niet ingesteldYou must enter a name for this entry.<br />Please enter a new name for this entry.U moet een naam opgeven voor dit item.<br />Geef alstublieft een naam op voor dit item.Duplicate NameDubbele naamOpenLP.ProjectorEditFormAdd New ProjectorNieuwe projector toevoegenEdit ProjectorProjector aanpassenIP AddressIP-adresPort NumberPoortnummerPINPINNameNaamLocationLocatieNotesAantekeningenDatabase ErrorDatabase foutThere was an error saving projector information. See the log for the errorEr is een fout opgetreden bij het opslaan van de projectorinformatie. Kijk in het logbestand voor de foutmeldingOpenLP.ProjectorManagerAdd ProjectorProjector toevoegenAdd a new projector.Voeg een nieuwe projector toe.Edit ProjectorProjector aanpassenEdit selected projector.Geselecteerde projector aanpassen.Delete ProjectorProjector verwijderenDelete selected projector.Verwijder geselecteerde projector.Select Input SourceSelecteer invoerbronChoose input source on selected projector.Selecteer invoerbron op geselecteerde projector.View ProjectorBekijk projectorView selected projector information.Bekijk informatie van geselecteerde projector.Connect to selected projector.Verbind met geselecteerde projector.Connect to selected projectorsVerbind met geselecteerde projectorsConnect to selected projectors.Verbind met geselecteerde projectors.Disconnect from selected projectorsVerbreek verbinding met geselecteerde projectorsDisconnect from selected projector.Verbreek verbinding met geselecteerde projector.Disconnect from selected projectorVerbreek verbinding met geselecteerde projectorDisconnect from selected projectors.Verbreek verbinding met geselecteerde projectors.Power on selected projectorGeselecteerde projector inschakelenPower on selected projector.Geselecteerde projector inschakelen.Power on selected projectors.Geselecteerde projectors inschakelen.Standby selected projectorGeselecteerde projector uitschakelenPut selected projector in standby.Geselecteerde projector in standby zetten.Put selected projectors in standby.Geselecteerde projectors in standby zetten.Blank selected projector screenGeselecteerd projectorscherm leegmakenBlank selected projectors screenGeselecteerde projectorschermen leegmakenBlank selected projectors screen.Geselecteerde projectorscherm leegmaken.Show selected projector screenGeselecteerd projectorscherm weergevenShow selected projector screen.Geselecteerd projectorscherm weergeven.Show selected projectors screen.Geselecteerd projectorscherm weergeven.&View Projector InformationProjectorinformatie &bekijken&Edit ProjectorProjector &aanpassen&Connect ProjectorProjector &verbindenD&isconnect ProjectorV&erbinding met projector verbrekenPower &On ProjectorProjector &inschakelenPower O&ff ProjectorProjector &uitschakelenSelect &InputSelecteer i&nvoerbronEdit Input SourceInvoerbron bewerken&Blank Projector ScreenProjectorscherm &leegmaken&Show Projector ScreenProjectorscherm &weergeven&Delete ProjectorProjector verwij&derenAre you sure you want to delete this projector?Weet u zeker dat u deze projector wilt verwijderen?NameNaamIPIP-adresPortPoortNotesAantekeningenProjector information not available at this time.Projectorinformatie is momenteel niet beschikbaar.Projector NameProjectornaamManufacturerFabrikantModelModelPJLink ClassSoftware VersionSerial NumberLamp Model NumberFilter Model NumberOther infoOverige informatiePower statusStatusShutter isLensbescherming isClosedDichtCurrent source input isHuidige invoerbron isUnavailableONOFFLampLampHoursUrenNo current errors or warningsGeen fouten en waarschuwingenCurrent errors/warningsFouten en waarschuwingenProjector InformationProjectorinformatieAuthentication ErrorAuthenticatieprobleemNo Authentication ErrorGeen authenticatie probleemNot Implemented YetNog niet geïmplementeerdOpenLP.ProjectorTabProjectorProjectorCommunication OptionsVerbindingsinstellingenConnect to projectors on startupVerbind met projectors tijdens het opstartenSocket timeout (seconds)Socket timeout (seconden)Poll time (seconds)Poll tijd (seconden)Tabbed dialog boxDialoogvenster met tabsSingle dialog boxEnkel dialoogvensterConnect to projector when LINKUP received (v2 only)Enable listening for PJLink2 broadcast messagesOpenLP.ProjectorWizardDuplicate IP AddressDubbel IP-adresInvalid IP AddressOngeldig IP-adresInvalid Port NumberOngeldig poortnummerOpenLP.ProxyDialogProxy Server SettingsOpenLP.ProxyWidgetProxy Server SettingsNo prox&y&Use system proxy&Manual proxy configuratione.g. proxy_server_address:port_noHTTP:HTTPS:Username:Gebruikersnaam:Password:Wachtwoord:OpenLP.RemotePluginImporting WebsiteOpenLP.ScreenScreen settings and screen setup is not the sameThere is a mismatch between screens and screen settings. OpenLP will try to automatically select a display screen, but you should consider updating the screen settings.OpenLP.ScreenListScreenSchermprimaryprimair schermOpenLP.ScreensTabScreensGeneric screen settingsDisplay if a single screenWeergeven bij enkel schermF&ull screenWidth:Breedte:Use this screen as a displayLeft:Custom &geometryTop:Height:Hoogte:Identify ScreensSelect a DisplayYou need to select at least one screen to be used as a display. Select the screen you wish to use as a display, and check the checkbox for that screen.OpenLP.ServiceItem[slide {frame:d}][slide {frame:d}]<strong>Start</strong>: {start}<strong>Start</strong>: {start}<strong>Length</strong>: {length}<strong>Duur</strong>: {length}OpenLP.ServiceItemEditFormReorder Service ItemLiturgie-onderdelen herschikkenOpenLP.ServiceManagerService Notes: Notes: Aantekeningen: Playing time: Speeltijd: Load an existing service.Laad een bestaande liturgie.Save this service.Deze liturgie opslaan.Select a theme for the service.Selecteer een thema voor de liturgie.Move to &topBovenaan plaa&tsenMove item to the top of the service.Plaats dit onderdeel bovenaan.Move &upVerplaats &omhoogMove item up one position in the service.Verplaats een plek omhoog.Move &downVerplaats o&mlaagMove item down one position in the service.Verplaats een plek omlaag.Move to &bottomOnderaan &plaatsenMove item to the end of the service.Plaats dit onderdeel onderaan.&Delete From ServiceVerwij&deren uit de liturgieDelete the selected item from the service.Verwijder dit onderdeel uit de liturgie.&Expand allAlles &uitklappenExpand all the service items.Alle liturgie-onderdelen uitklappen.&Collapse allAlles &inklappenCollapse all the service items.Alle liturgie-onderdelen inklappen.Go LiveGa liveSend the selected item to Live.Toon selectie live.&Add New Item&Voeg toe&Add to Selected Item&Voeg toe aan geselecteerd item&Edit ItemB&ewerk onderdeel&Rename...He&rnoemen...&Reorder ItemHe&rschik onderdeel&NotesAa&ntekeningen&Start Time&StarttijdCreate New &Custom Slide&Creëren nieuwe aangepaste dia&Auto play slides&Automatisch afspelen dia'sAuto play slides &LoopAutomatisch door&lopend dia's afspelenAuto play slides &OnceAutomatisch &eenmalig dia's afspelen&Delay between slidesPauze tussen dia’s.Show &PreviewToon &voorbeeld&Change Item Theme&Wijzig onderdeel themaUntitled ServiceLiturgie zonder naamOpen FileOpen bestandOpenLP Service Files (*.osz *.oszl)OpenLP Service bestanden (*.osz *.oszl)Modified ServiceGewijzigde liturgie The current service has been modified. Would you like to save this service?De huidige liturgie is gewijzigd. Veranderingen opslaan?Service File(s) MissingOntbrekend(e) liturgiebestand(en)The following file(s) in the service are missing: {name}
These files will be removed if you continue to save.Error Saving FileFout bij het opslaanThere was an error saving your file.
{error}OpenLP Service Files - lite (*.oszl)OpenLP Service Files (*.osz)OpenLP liturgie bestanden (*.osz)The service file {file_path} could not be loaded because it is either corrupt, inaccessible, or not a valid OpenLP 2 or OpenLP 3 service file.&Auto Start - active&Auto Start - actief&Auto Start - inactive&Auto Start - inactiefInput delayInvoeren vertragingDelay between slides in seconds.Pauze tussen dia’s in seconden.EditBewerkService copy onlyLiturgie alleen kopiërenSlide themeDia themaNotesAantekeningenMissing Display HandlerOntbrekende weergaveregelaarYour item cannot be displayed as there is no handler to display itDit onderdeel kan niet weergegeven worden, omdat er een regelaar ontbreektYour item cannot be displayed as the plugin required to display it is missing or inactiveDit onderdeel kan niet weergegeven worden omdat de benodigde plug-in ontbreekt of inactief isRename item titleTitel hernoemenTitle:Titel:OpenLP.ServiceNoteFormService Item NotesAantekeningenOpenLP.SettingsFormConfigure OpenLPConfigureer OpenLPOpenLP.ShortcutListDialogConfigure ShortcutsSneltoetsen instellenSelect an action and click one of the buttons below to start capturing a new primary or alternate shortcut, respectively.Selecteer een actie en klik op één van de knoppen hieronder om respectievelijk een primaire of alternatieve sneltoets vast te leggen.ActionActieShortcutSneltoetsAlternateAlternatiefDefaultStandaardCustomAangepastCapture shortcut.Sneltoets vastleggen.Restore the default shortcut of this action.Herstel de standaard sneltoets voor de actie.Restore Default ShortcutsHerstel alle standaard sneltoetsenDo you want to restore all shortcuts to their defaults?Weet u zeker dat u alle standaard sneltoetsen wilt herstellen?The shortcut "{key}" is already assigned to another action,
please use a different shortcut.Duplicate ShortcutSneltoets duplicerenOpenLP.ShortcutListFormSelect an ActionSelect an action and click one of the buttons below to start capturing a new primary or alternate shortcut, respectively.Selecteer een actie en klik op één van de knoppen hieronder om respectievelijk een primaire of alternatieve sneltoets vast te leggen.OpenLP.SlideControllerPrevious SlideVorige diaMove to previous.Vorige.Next SlideVolgende diaMove to next.Volgende.HideVerbergenShow PresentationShow ThemeShow BlackShow DesktopToon bureaubladPlay SlidesDia’s tonenDelay between slides in seconds.Pauze tussen dia’s in seconden.Move to live.Toon live.Add to Service.Voeg toe aan liturgie.Edit and reload song preview.Bewerken en liedvoorbeeld opnieuw laden.ClearStart playing media.Start afspelen media.Pause playing media.Afspelen pauzeren.Stop playing media.Afspelen stoppen.Loop playing media.Continu media afspelen.Video timer.Video timer.Video position.Video positie.Audio Volume.Audio volume.Go to "Verse"Ga naar "Vers"Go to "Chorus"Ga naar "Refrein"Go to "Bridge"Ga naar "Bridge"Go to "Pre-Chorus"Ga naar "pre-Refrein"Go to "Intro"Ga naar "Intro"Go to "Ending"Ga naar "Einde"Go to "Other"Ga naar "Overige"Go ToGa naarPrevious ServiceVorige liturgieNext ServiceVolgende liturgieOpenLP.SourceSelectFormIgnoring current changes and return to OpenLPVergeet de wijzigingen en keer terug naar OpenLPDelete all user-defined text and revert to PJLink default textVerwijder alle aangepaste teksten en herstel de standaardteksten van PJLinkDiscard changes and reset to previous user-defined textVergeet aanpassingen en herstel de vorige aangepaste tekstSave changes and return to OpenLPWijzigingen opslaan en terugkeren naar OpenLPEdit Projector Source TextProjectorbron-tekst aanpassenSelect Projector SourceSelecteer projectorbronDelete entries for this projectorVerwijder items voor deze projectorAre you sure you want to delete ALL user-defined source input text for this projector?Weet u zeker dat u ALLE ingevoerde bronteksten van deze projector wilt verwijderen?OpenLP.SpellTextEditLanguage:Taal:Spelling SuggestionsSpelling suggestiesFormatting TagsOpmaaktagsOpenLP.StartTimeFormTheme LayoutThema layoutThe blue box shows the main area.Het blauwe vlak toont het hoofdgebied.The red box shows the footer.Het rode vlak toont het gebied voor de voettekst.OpenLP.StartTime_formItem Start and Finish TimeItem start- en eindtijdHours:Uren:Minutes:Minuten:Seconds:Seconden:StartStartFinishVoltooienLengthLengteTime Validation ErrorTijd validatie foutFinish time is set after the end of the media itemEindtijd is ingesteld tot na het eind van het media itemStart time is after the finish time of the media itemStarttijd is ingesteld tot na het eind van het media itemOpenLP.ThemeForm(approximately %d lines per slide)(ongeveer %d regels per dia)OpenLP.ThemeManagerCreate a new theme.Maak een nieuw thema.Edit ThemeBewerk themaEdit a theme.Bewerk een thema.Delete ThemeVerwijder themaDelete a theme.Verwijder thema.Import ThemeImporteer themaImport a theme.Importeer thema.Export ThemeExporteer themaExport a theme.Exporteer thema.&Edit ThemeB&ewerk thema&Copy Theme&Kopieer thema&Rename ThemeHe&rnoem thema&Delete ThemeVerwij&der themaSet As &Global DefaultInstellen als al&gemene standaard&Export Theme&Exporteer thema{text} (default){text} (default)You must select a theme to rename.Selecteer een thema om te hernoemen.Rename ConfirmationBevestig hernoemenRename {theme_name} theme?Copy of {name}Copy of <theme name>Kopie van {name}You must select a theme to edit.Selecteer een thema om te bewerken.You must select a theme to delete.Selecteer een thema om te verwijderen.Delete ConfirmationBevestig verwijderenDelete {theme_name} theme?You have not selected a theme.Selecteer een thema.Save Theme - ({name})OpenLP Themes (*.otz)OpenLP Thema's (*.otz)Theme ExportedThema geëxporteerdYour theme has been successfully exported.Het thema is succesvol geëxporteerd.Theme Export FailedExporteren thema is misluktThe {theme_name} export failed because this error occurred: {err}Select Theme Import FileSelecteer te importeren thema-bestand{name} (default){name} (default)Theme Already ExistsThema bestaat alTheme {name} already exists. Do you want to replace it?Import ErrorThere was a problem importing {file_name}.
It is corrupt, inaccessible or not a valid theme.Validation ErrorValidatie foutA theme with this name already exists.Er bestaat al een thema met deze naam.You are unable to delete the default theme.Het standaard thema kan niet worden verwijderd.{count} time(s) by {plugin}Unable to delete themeHet thema kan niet worden verwijderdTheme is currently used
{text}OpenLP.ThemeWizardHorizontal Align:Horizontaal uitlijnen:LeftLinksRightRechtsCenterCentrerenJustifyUitvullenEnable transitionsEffect:FadeSlideConcaveConvexZoomSpeed:NormalFastSlowDirection:HorizontalHorizontaalVerticalVerticaalReverse&Main Area&Hoofdgebied&Use default locationGebr&uik standaardlocatieX position:X positie:pxpxY position:Y positie:Width:Breedte:Height:Hoogte:&Footer Area&Voettekst gebiedUse default locationGebruik standaardlocatieSelect ImageSelecteer afbeeldingSelect VideoSelecteer videoBackground type:Achtergrond type:Solid colorVaste kleurGradientKleurverloopTransparentTransparantLive streamColor:Kleur:Starting color:Beginkleur:Ending color:Eindkleur:Gradient:Kleurverloop:CircularRadiaalTop Left - Bottom RightLinks boven - rechts onderBottom Left - Top RightLinks onder - Rechts bovenBackground color:Achtergrondkleur:Background Image EmptyAchtergrondafbeelding leegYou have not selected a background image. Please select one before continuing.Geen achtergrondafbeelding geselecteerd. Selecteer er een om door te gaan.Background Video EmptyYou have not selected a background video. Please select one before continuing.Background Stream EmptyYou have not selected a background stream. Please select one before continuing.Edit Theme - {name}Bewerk thema - {name}Theme Name MissingThema naam ontbreektThere is no name for this theme. Please enter one.Dit thema heeft geen naam. Voer een naam in.Theme Name InvalidThema naam ongeldigInvalid theme name. Please enter one.De naam van het thema is niet geldig. Voer een andere naam in.Theme WizardThema AssistentWelcome to the Theme WizardWelkom bij de Thema AssistentThis wizard will help you to create and edit your themes. Click the next button below to start the process by setting up your background.Deze Assistent helpt bij het maken en bewerken van thema's. Klik op volgende om als eerste stap een achtergrond in te stellen.Set Up BackgroundAchtergrond instellenSet up your theme's background according to the parameters below.Thema achtergrond instellen met onderstaande parameters.Main Area Font DetailsLettertype instellingen hoofdgebiedDefine the font and display characteristics for the Display textStel de eigenschappen voor de tekstweergave inFooter Area Font DetailsLettertype instellingen voettekstDefine the font and display characteristics for the Footer textStel de eigenschappen voor de voettekst weergave inText Formatting DetailsTekst opmaak eigenschappenAllows additional display formatting information to be definedToestaan dat er afwijkende opmaak kan worden bepaaldOutput Area LocationsUitvoer gebied locatiesAllows you to change and move the Main and Footer areas.Toestaan dat tekstvelden gewijzigd en verplaatst worden.Layout PreviewLayout voorbeeldPreview and SaveVoorbeeld en opslaanPreview the theme and save it.Toon een voorbeeld en sla het thema op.Theme name:Themanaam:OpenLP.ThemesRecreating Theme ThumbnailsOpenLP.ThemesTabThemesThema'sGlobal ThemeGlobaal themaUniversal SettingsGlobale instellingen&Transition between service items&Reload live theme when changedTheme LevelThema niveauS&ong Level&Lied niveauUse the theme from each song in the database. If a song doesn't have a theme associated with it, then use the service's theme. If the service doesn't have a theme, then use the global theme.Gebruik het liedspecifieke thema uit de database. Als een lied geen eigen thema heeft, gebruik dan het thema van de liturgie. Als de liturgie geen eigen thema heeft, gebruik dan het globale thema.&Service Level&Liturgie niveauUse the theme from the service, overriding any of the individual songs' themes. If the service doesn't have a theme, then use the global theme.Gebruik het thema van de liturgie en negeer de liedspecifieke thema's. Als de liturgie geen eigen thema heeft, gebruik dan het globale thema.&Global Level&Globaal niveauUse the global theme, overriding any themes associated with either the service or the songs.Gebruik het globale thema en negeer alle specifieke thema's van liturgie en liederen.OpenLP.UiAboutOver&Add&ToevoegenAdd groupVoeg groep toeAdd group.AdvancedGeavanceerdAll FilesAlle bestandenAutomaticAutomatischBackground ColorAchtergrondkleurBackground color:Achtergrondkleur:Search is Empty or too Short<strong>The search you have entered is empty or shorter than 3 characters long.</strong><br><br>Please try again with a longer search.No Bibles AvailableGeen bijbels beschikbaar<strong>There are no Bibles currently installed.</strong><br><br>Please use the Import Wizard to install one or more Bibles.BottomOnderBrowse...Bladeren...CancelAnnuleerCCLI number:CCLI nummer:CCLI song number:CCLI liednummer:Create a new service.Maak nieuwe liturgie.Confirm DeleteBevestig verwijderenContinuousDoorlopendDefaultStandaardDefault Color:Standaardkleur:Service %Y-%m-%d %H-%MThis may not contain any of the following characters: /\?*|<>[]":+
See http://docs.python.org/library/datetime.html#strftime-strptime-behavior for more information.Liturgie %d-%m-%Y %H-%M&DeleteVerwij&derenDisplay style:Weergave stijl:Duplicate ErrorDuplicaat fout&Edit&BewerkenEmpty FieldLeeg veldErrorFoutExportExporterenFileBestandFile appears to be corrupt.ptAbbreviated font point size unitptHelpHelphThe abbreviated unit for hoursuInvalid Folder SelectedSingularOngeldige map geselecteerdInvalid File SelectedSingularOngeldig bestand geselecteerdInvalid Files SelectedPluralOngeldige bestanden geselecteerdImageAfbeeldingImportImporterenLayout style:Dia layout:LiveLiveLive StreamLive Background ErrorLive achtergrond foutLive ToolbarLive WerkbalkLoadLaadManufacturerSingularFabrikantManufacturersPluralFabrikantenModelSingularModelModelsPluralModellenmThe abbreviated unit for minutesmMiddleMiddenNewNieuwNew ServiceNieuwe liturgieNew ThemeNieuw themaNext TrackVolgende trackNo Folder SelectedSingularGeen map geselecteerdNo File SelectedSingularGeen bestand geselecteerdNo Files SelectedPluralGeen bestanden geselecteerdNo Item SelectedSingularGeen item geselecteerdNo Items SelectedPluralGeen items geselecteerdNo Search ResultsNiets gevondenOpenLPOpenLPOpenLP Song DatabaseOpenLP is already running on this machine.
Closing this instanceOpen service.Open liturgie.Optional, this will be displayed in footer.Optional, this won't be displayed in footer.Play Slides in LoopDia’s doorlopend tonenPlay Slides to EndDia’s tonen tot eindPreviewVoorbeeldPreview ToolbarVoorbeeld WerkbalkPrint ServiceLiturgie afdrukkenProjectorSingularProjectorProjectorsPluralProjectorsReplace BackgroundVervang achtergrondReplace live background.Vervang Live achtergrond.Replace live background is not available when the WebKit player is disabled.Vervang live achtergrond is niet beschikbaar wanneer de WebKit-speler uitgeschakeld is.Reset BackgroundHerstel achtergrondReset live background.Herstel Live achtergrond.Required, this will be displayed in footer.sThe abbreviated unit for secondssSave && PreviewOpslaan && voorbeeld bekijkenSearchZoekSearch Themes...Search bar place holder text Zoek op thema...You must select an item to delete.Selecteer een item om te verwijderen.You must select an item to edit.Selecteer een item om te bewerken.SettingsInstellingenSave ServiceLiturgie opslaanServiceLiturgiePlease type more text to use 'Search As You Type'Optional &SplitOptioneel &splitsenSplit a slide into two only if it does not fit on the screen as one slide.Dia opdelen als de inhoud niet op één dia past.Starting import...Start importeren...Stop Play Slides in LoopStop dia’s doorlopend tonenStop Play Slides to EndStop dia’s tonen tot eindThemeSingularThemaThemesPluralThema'sToolsHulpmiddelenTopBovenUnsupported FileBestandsformaat wordt niet ondersteundVerse Per SlideBijbelvers per diaVerse Per LineBijbelvers per regelVersionVersieViewWeergaveView ModeWeergave modusVideoVideoWeb Interface, Download and Install Latest VersionThere was a problem advertising OpenLP's remote interface on the network:An unknown error occurredOpenLP already seems to be advertising itselfBook ChapterBoek hoofdstukChapterHoofdstukVerseCoupletPsalmPsalmBook names may be shortened from full names, for an example Ps 23 = Psalm 23Written byGeschreven doorDelete the selected item.Verwijder het geselecteerde item.Move selection up one position.Verplaats selectie een plek naar boven.Move selection down one position.Verplaats selectie een plek naar beneden.&Vertical Align:&Verticaal uitlijnen:Finished import.Importeren afgerond.Format:Formaat:ImportingImporterenImporting "{source}"...Select Import SourceSelecteer te importeren bestandSelect the import format and the location to import from.Selecteer te importeren bestand en het bestandsformaat.Open {file_type} FileOpen {folder_name} Folder%p%%p%Ready.Klaar.You need to specify one %s file to import from.A file type e.g. OpenSongSpecificeer een %s bestand om vanuit te importeren.You need to specify at least one %s file to import from.A file type e.g. OpenSongSelecteer minstens één %s bestand om te importeren.You need to specify one %s folder to import from.A song format e.g. PowerSongSpecificeer een %s map om uit te importeren.Welcome to the Bible Import WizardWelkom bij de Bijbel Importeren AssistentWelcome to the Duplicate Song Removal WizardWelkom bij de Dubbele Liederen VerwijderingsassistentWelcome to the Song Export WizardWelkom bij de Lied Exporteren AssistentWelcome to the Song Import WizardWelkom bij de Lied Importeren AssistentAuthorSingularAuteurAuthorsPluralAuteursAuthor UnknownAuteur onbekendSongbookSingularLiedboekSongbooksPluralLiedboekenTitle and/or verses not foundTitel en/of verzen niet gevondenSong MaintenanceLiedbeheerTopicSingularOnderwerpTopicsPluralOnderwerpenXML syntax errorXML syntax foutOpenLP.core.lib{one} and {two}{one} en {two}{first} and {last}{first} en {last}OpenPL.PJLinkOtherOverigOpenlp.ProjectorTabSource select dialog interfaceBronselectie dialoogvensterPlanningCenterPluginPlanningCenterPlanning Center ServiceImport Planning Center Service Plan from Planning Center Online.<strong>PlanningCenter Plugin</strong><br />The planningcenter plugin provides an interface to import service plans from the Planning Center Online v2 API.PlanningCentername singularPlanningCentername pluralPlanningCentercontainer titleImport All Plan Items into Current ServicePlanningCenterPlugin.PlanningCenterAuthFormTest CredentialsPlanningCenterPlugin.PlanningCenterFormPlanning Center Online Service ImporterService TypeSelect PlanImport NewImport As New ServiceRefresh ServiceRefresh Existing Service from Planning Center. This will update song lyrics or item orders that have changedEdit AuthenticationEdit the Application ID and Secret Code to login to Planning Center OnlineSong ThemeSlide ThemePlanningCenterPlugin.PlanningCenterTabAuthentication SettingsApplication ID:Secret:<strong>Note:</strong> An Internet connection and a Planning Center Online Account are required in order to import plans from Planning Center Online.Enter your <b>Planning Center Online</b> <i>Personal Access Token</i> details in the text boxes below. Personal Access Tokens are created by doing the following:
<ol>
<li>Login to your Planning Center Online account at<br>
<a href=https://api.planningcenteronline.com/oauth/applications>
https://api.planningcenteronline.com/oauth/applications</a></li>
<li>Click the "New Personal Access Token" button at the bottom of the screen.</li>
<li>Enter a description of your use case (eg. "OpenLP Integration")</li>
<li>Copy and paste the provided Application ID and Secret values below.</li>
</ol>PresentationPlugin<strong>Presentation Plugin</strong><br />The presentation plugin provides the ability to show presentations using a number of different programs. The choice of available presentation programs is available to the user in a drop down box.<strong>Presentatie plug-in</strong><br />De presentatie plug-in voorziet in de mogelijkheid om verschillende soorten presentaties weer te geven. Met een keuzemenu kan gekozen worden uit de beschikbare presentatiesoftware.Presentationname singularPresentatiePresentationsname pluralPresentatiesPresentationscontainer titlePresentatiesLoad a new presentation.Laad nieuwe presentatie.Delete the selected presentation.Geselecteerde presentatie verwijderen.Preview the selected presentation.Geef van geselecteerde presentatie voorbeeld weer.Send the selected presentation live.Geselecteerde presentatie Live tonen.Add the selected presentation to the service.Voeg geselecteerde presentatie toe aan de liturgie.PresentationPlugin.MediaItemSelect Presentation(s)Selecteer presentatie(s)AutomaticAutomatischPresent using:Presenteren met:Presentations ({text})Presentaties ({text})File ExistsBestand bestaatA presentation with that filename already exists.Er bestaat al een presentatie met die naam.This type of presentation is not supported.Dit type presentatie wordt niet ondersteund.Missing PresentationOntbrekende presentatieThe presentation {name} no longer exists.The presentation {name} is incomplete, please reload.PresentationPlugin.PowerpointDocumentAn error occurred in the PowerPoint integration and the presentation will be stopped. Restart the presentation if you wish to present it.PresentationPlugin.PresentationTabAvailable ControllersBeschikbare presentatieprogramma'sPowerPoint optionsPowerPoint-instellingenAllow presentation application to be overriddenAnder presentatieprogramma selecteren toestaanClicking on the current slide advances to the next effectLet PowerPoint control the size and monitor of the presentations
(This may fix PowerPoint scaling issues in Windows 8 and 10){name} (unavailable){name} (unavailable)RemotePlugin.RemoteTabRemote InterfaceServer SettingsServer instellingenIP address:Port number:Poort nummer:Remote URL:Remote URL:Stage view URL:Podium weergave URL:Live view URL:Live meekijk URL:Chords view URL:Display stage time in 12h formatToon tijd in am/pm formaatShow thumbnails of non-text slides in remote and stage view.Toon miniatuurweergaven van niet-tekst-dia's in remote- en podiumweergaven.Remote AppScan the QR code or click <a href="{qr}">download</a> to download an app for your mobile deviceUser AuthenticationGebruikersverificatieWeb RemoteCheck for UpdatesUpgradeUser id:Gebruikersnaam:Password:Wachtwoord:Current version:Latest version:(unknown)SongPlugin.ReportSongListSave Filesong_extract.csvsong_extract.csvCSV format (*.csv)CSV formaat (*.csv)Report CreationRapportage opslaanReport
{name}
has been successfully created. Song Extraction FailedAn error occurred while extracting: {error}SongUsagePlugin&Song Usage Tracking&Liedgebruik bijhouden&Delete Tracking DataVerwij&der liedgebruik gegevensDelete song usage data up to a specified date.Verwijder alle gegevens over liedgebruik tot een bepaalde datum.&Extract Tracking Data&Exporteer liedgebruik gegevensGenerate a report on song usage.Geneer rapportage liedgebruik.Toggle TrackingGegevens bijhouden aan|uitToggle the tracking of song usage.Liedgebruik gegevens bijhouden aan of uit zetten.Song UsageLiedgebruikSong usage tracking is active.Liedgebruik bijhouden is actief.Song usage tracking is inactive.Liedgebruik bijhouden is inactief.displayweergaveprintedafgedrukt<strong>SongUsage Plugin</strong><br />This plugin tracks the usage of songs in services.<strong>Liedgebruik plug-in</strong><br />Met deze plug-in kunt u bijhouden welke liederen tijdens de vieringen gezongen worden.SongUsagename singularLiedgebruikSongUsagename pluralLiedgebruikSongUsagecontainer titleLiedgebruikSongUsagePlugin.SongUsageDeleteFormDelete Song Usage DataLiedgebruik gegevens verwijderenSelect the date up to which the song usage data should be deleted.
All data recorded before this date will be permanently deleted.Selecteer de datum tot wanneer de liedgebruikgegevens verwijderd moeten worden.
Alle gegevens van voor die datum zullen worden verwijderd.Delete Selected Song Usage Events?Wilt u de liedgebruik gegevens verwijderen?Are you sure you want to delete selected Song Usage data?Weet u zeker dat u de liedgebruik gegevens wilt verwijderen?Deletion SuccessfulSuccesvol verwijderdAll requested data has been deleted successfully.Alle opgegeven data is succesvol verwijderd.SongUsagePlugin.SongUsageDetailFormSong Usage ExtractionLiedgebruik gegevens exporterenSelect Date RangeSelecteer periodetototReport LocationLocatie rapportOutput Path Not SelectedUitvoer pad niet geselecteerdYou have not set a valid output location for your song usage report.
Please select an existing path on your computer.usage_detail_{old}_{new}.txtusage_detail_{old}_{new}.txtReport CreationRapportage opslaanReport
{name}
has been successfully created.Report Creation FailedOverzicht maken misluktAn error occurred while creating the report: {error}SongsPluginArabic (CP-1256)Arabisch (CP-1256)Baltic (CP-1257)Baltisch (CP-1257)Central European (CP-1250)Centraal Europees (CP-1250)Cyrillic (CP-1251)Cyrillisch (CP-1251)Greek (CP-1253)Grieks (CP-1253)Hebrew (CP-1255)Hebreeuws (CP-1255)Japanese (CP-932)Japans (CP-932)Korean (CP-949)Koreaans (CP-949)Simplified Chinese (CP-936)Chinees, eenvoudig (CP-936)Thai (CP-874)Thais (CP-874)Traditional Chinese (CP-950)Traditioneel Chinees (CP-950)Turkish (CP-1254)Turks (CP-1254)Vietnam (CP-1258)Vietnamees (CP-1258)Western European (CP-1252)Westeuropees (CP-1252)Character EncodingTekst coderingThe codepage setting is responsible
for the correct character representation.
Usually you are fine with the preselected choice.De tekstcodering is verantwoordelijk voor
een correcte weergave van lettertekens.
Meestal voldoet de suggestie van OpenLP.Please choose the character encoding.
The encoding is responsible for the correct character representation.Kies een tekstcodering (codepage).
De tekstcodering is verantwoordelijk voor een correcte weergave van lettertekens.&Song&LiedImport songs using the import wizard.Importeer liederen met de Importeren Assistent.CCLI SongSelectCCLI SongSelectImport songs from CCLI's SongSelect service.Importeer liederen vanuit CCLI's SongSelect service.Exports songs using the export wizard.Exporteer liederen met de Exporteren Assistent.SongsLiederen&Re-index SongsHe&r-indexeer liederenRe-index the songs database to improve searching and ordering.Her-indexeer de liederen in de database om het zoeken en ordenen te verbeteren.Find &Duplicate SongsZoek &dubbele liederenFind and remove duplicate songs in the song database.Zoek en verwijder dubbele liederen in de liederendatabase.Song List ReportProduce a CSV file of all the songs in the database.Reindexing songs...Liederen her-indexeren...Reindexing songsHerindexeren liederen<strong>Songs Plugin</strong><br />The songs plugin provides the ability to display and manage songs.<strong>Lied plug-in</strong><br />De lied plug-in regelt de weergave en het beheer van liederen.Songname singularLiedSongsname pluralLiederenSongscontainer titleLiederenAdd a new song.Voeg nieuw lied toe.Edit the selected song.Bewerk het geselecteerde lied.Delete the selected song.Verwijder het geselecteerde lied.Preview the selected song.Toon voorbeeld van het geselecteerde lied.Send the selected song live.Toon het geselecteerde lied Live.Add the selected song to the service.Voeg geselecteerd lied toe aan de liturgie.Importing SongsLiederen importerenSongsPlugin.AuthorTypeWordsAuthor who wrote the lyrics of a songTekstMusicAuthor who wrote the music of a songMuziekWords and MusicAuthor who wrote both lyrics and music of a songTekst en muziekTranslationAuthor who translated the songVertalingSongsPlugin.AuthorsFormAuthor MaintenanceAuteur beheerDisplay name:Weergave naam:First name:Voornaam:Last name:Achternaam:You need to type in the first name of the author.De voornaam van de auteur moet worden opgegeven.You need to type in the last name of the author.De achternaam van de auteur moet worden opgegeven.You have not set a display name for the author, combine the first and last names?Geen weergave naam opgegeven. Moeten de voor- en achternaam gecombineerd worden?SongsPlugin.CCLIFileImportThe file contains unreadable characters.The file does not have a valid extension.Dit bestand heeft geen geldige extensie.SongsPlugin.DreamBeamImportInvalid DreamBeam song file. Missing DreamSong tag.Ongeldig DreamBeam liedbestand. Ontbrekende DreamSong tag.SongsPlugin.EasySlidesImportInvalid EasySlides song file. Missing Item tag.SongsPlugin.EasyWorshipSongImportAdministered by {admin}Beheerd door {admin}"{title}" could not be imported. {entry}This file does not exist.Het bestand bestaat niet.Could not find the "Songs.MB" file. It must be in the same folder as the "Songs.DB" file.Kon het bestand "Songs.MB" niet vinden. Het moet in dezelfde map staan als het bestand "Songs.DB".This file is not a valid EasyWorship database.Dit is geen geldige EasyWorship-database.Could not retrieve encoding.Kon de encoding niet bepalen."{title}" could not be imported. {error}This does not appear to be a valid Easy Worship 6 database directory.This is not a valid Easy Worship 6 database.Unexpected data formatting.Onverwacht bestandsformaat.No song text found.Geen liedtekst gevonden.
[above are Song Tags with notes imported from EasyWorship]
[hierboven staan Liedtags met noten die zijn geïmporteerd uit EasyWorship]SongsPlugin.EditBibleFormMeta DataAlgemene informatieCustom Book NamesAangepaste namen bijbelboekenSongsPlugin.EditSongForm&Save && CloseSong EditorLied editor&Title:&Titel:Alt&ernate title:Alt&ernatieve titel:&Lyrics:Lied&tekst:&Verse order:&Vers volgorde:Ed&it All&Alles bewerkenTitle && LyricsTitel && Liedtekst&Add to SongVoeg toe &aan lied&Edit Author TypeAut&eurstype aanpassen&RemoveVe&rwijderen&Manage Authors, Topics, Songbooks&Beheer auteurs, onderwerpen, liedboekenA&dd to SongVoeg toe &aan liedR&emoveV&erwijderenAdd &to SongVoeg toe &aan liedRe&moveVer&wijderenAuthors, Topics && SongbooksAuteurs, onderwerpen && liedboekenNew &ThemeNieuw &ThemaCopyright InformationCopyrightCommentsCommentarenTheme, Copyright Info && CommentsThema, Copyright && CommentarenLinked AudioGekoppelde audioAdd &File(s)Bestand(en) &toevoegenAdd &MediaVoeg &Media toeRemove &All&Alles verwijderen<strong>Warning:</strong> Not all of the verses are in use.<strong>Let op:</strong> Niet alle verzen worden gebruikt.<strong>Warning:</strong> You have not entered a verse order.<strong>Waarschuwing:</strong> U hebt geen volgorde opgegeven voor de verzen.There are no verses corresponding to "{invalid}". Valid entries are {valid}.
Please enter the verses separated by spaces.There is no verse corresponding to "{invalid}". Valid entries are {valid}.
Please enter the verses separated by spaces.Invalid Verse OrderOngeldige vers volgordeYou need to type in a song title.Vul de titel van het lied in.You need to type in at least one verse.Vul minstens de tekst van één couplet in.You need to have an author for this song.Selecteer minimaal één auteur voor dit lied.There are misplaced formatting tags in the following verses:
{tag}
Please correct these tags before continuing.You have {count} verses named {name} {number}. You can have at most 26 verses with the same nameAdd AuthorVoeg auteur toeThis author does not exist, do you want to add them?Deze auteur bestaat nog niet, toevoegen?This author is already in the list.Deze auteur staat al in de lijst.You have not selected a valid author. Either select an author from the list, or type in a new author and click the "Add Author to Song" button to add the new author.Geen auteur geselecteerd. Kies een auteur uit de lijst of voeg er een toe door de naam in te typen en op de knop "Voeg auteur toe" te klikken.Edit Author TypeAuteurstype aanpassenChoose type for this authorKies het type van deze auteurAdd TopicVoeg onderwerp toeThis topic does not exist, do you want to add it?Dit onderwerp bestaat nog niet, toevoegen?This topic is already in the list.Dit onderwerp staat al in de lijst.You have not selected a valid topic. Either select a topic from the list, or type in a new topic and click the "Add Topic to Song" button to add the new topic.Geen geldig onderwerp geselecteerd. Kies een onderwerp uit de lijst of type een nieuw onderwerp en klik op "Nieuw onderwerp toevoegen".Add SongbookVoeg liedboek toeThis Songbook does not exist, do you want to add it?Dit liedboek bestaat nog niet, toevoegen?This Songbook is already in the list.Dit liedboek staat al in de lijst.You have not selected a valid Songbook. Either select a Songbook from the list, or type in a new Songbook and click the "Add to Song" button to add the new Songbook.Geen geldig liedboek geselecteerd. Kies een liedboek uit de lijst of type de naam van een liedboek en klik op "Nieuw liedboek toevoegen".Open File(s)Open bestand(en)SongsPlugin.EditVerseFormEdit VerseCouplet bewerken&Verse type:Co&uplet type:&Forced SplitSplit the verse when displayed regardless of the screen size.&Insert&InvoegenSplit a slide into two by inserting a verse splitter.Dia opsplitsen door een dia 'splitter' in te voegen.Transpose:UpOmhoogDownOmlaagTransposing failedInvalid ChordSongsPlugin.ExportWizardFormSelect Destination FolderSelecteer een doelmapSong Export WizardLied Exporteren AssistentThis wizard will help to export your songs to the open and free <strong>OpenLyrics </strong> worship song format.Deze assistent helpt u bij het exporteren van liederen naar het open en vrije <strong>OpenLyrics</strong> worship lied formaat.Select SongsSelecteer liederenCheck the songs you want to export.Selecteer de liederen die u wilt exporteren.Uncheck AllDeselecteer allesCheck AllSelecteer allesSelect DirectorySelecteer mapSelect the directory where you want the songs to be saved.Selecteer een map waarin de liederen moeten worden bewaard.Directory:Map:ExportingExporterenPlease wait while your songs are exported.Een moment geduld terwijl de liederen worden geëxporteerd.You need to add at least one Song to export.Kies minstens één lied om te exporteren.No Save Location specifiedGeen map opgegevenYou need to specify a directory.Geef aan waar het bestand moet worden opgeslagen.Starting export...Start exporteren...SongsPlugin.FoilPresenterSongImportInvalid Foilpresenter song file. Missing expected tagsInvalid Foilpresenter song file. No verses found.Onbruikbaar Foilpresenter liederenbestand. Geen verzen gevonden.SongsPlugin.GeneralTabEnable search as you typeZoeken tijdens het typenSongsPlugin.ImportWizardFormSong Import WizardLied Importeren AssistentThis wizard will help you to import songs from a variety of formats. Click the next button below to start the process by selecting a format to import from.Deze Assistent helpt liederen in verschillende bestandsformaten te importeren in OpenLP. Klik op volgende en kies daarna het bestandsformaat van het te importeren lied.Add Files...Toevoegen...Remove File(s)Verwijder bestand(en)Please wait while your songs are imported.Een moment geduld terwijl de liederen worden geïmporteerd.CopyKopieerSave to FileOpslaan als bestandYour Song import failed. {error}This importer has been disabled.Deze importeerder is uitgeschakeld.OpenLyrics FilesOpenLyrics bestandenOpenLyrics or OpenLP 2 Exported SongOpenLyrics of OpenLP 2 geëxporteerd liedOpenLP 2 DatabasesOpenLP 2 DatabasesGeneric Document/PresentationAlgemeen Document/PresentatieThe generic document/presentation importer has been disabled because OpenLP cannot access OpenOffice or LibreOffice.Algemeen document/presentatie import is uitgeschakeld omdat OpenLP zowel OpenOffice als LibreOffice niet kan vinden op deze computer.Select Document/Presentation FilesSelecteer Documenten/Presentatie bestandenCCLI SongSelect FilesCCLI SongSelect bestandenChordPro FilesDreamBeam Song FilesDreamBeam liedbestandenEasySlides XML FileEasySlides XML bestandEasyWorship Song DatabaseEasyWorship lied databaseEasyWorship 6 Song Data DirectoryEasyWorship Service FileEasyWorship dienstbestandFoilpresenter Song FilesFoilpresenter liedbestandenLiveWorship DatabaseFirst convert your LiveWorship database to an XML text file, as explained in the <a href="http://manual.openlp.org/songs.html#importing-from-liveworship">User Manual</a>.LyriX FilesLyriX-bestandenLyriX (Exported TXT-files)LyriX (geëxporteerde TXT-bestanden)MediaShout DatabaseMediaShout databaseThe MediaShout importer is only supported on Windows. It has been disabled due to a missing Python module. If you want to use this importer, you will need to install the "pyodbc" module.MediaShout importeren wordt alleen ondersteund onder Windows. Het is uitgeschakeld omdat een bepaalde Python module ontbreekt. Om te kunnen importeren moet u de "pyodbc" module installeren.OPS Pro databaseOPS Pro databaseThe OPS Pro importer is only supported on Windows. It has been disabled due to a missing Python module. If you want to use this importer, you will need to install the "pyodbc" module.De OPS Pro Importer wordt alleen ondersteund onder Windows. Het is uitgeschakeld omdat een bepaalde Python module ontbreekt. Om te kunnen importeren moet u de "pyodbc" module installeren.PowerPraise Song FilesPowerPraise liedbestandenYou need to specify a valid PowerSong 1.0 database folder.Specificeer een geldige PowerSong 1.0 databasemap.PresentationManager Song FilesPresentationManager liedbestandenProPresenter Song FilesProPresenter liedbestandenSinging The Faith Exported FilesFirst use Singing The Faith Electronic edition to export the song(s) in Text format.SongBeamer FilesSongBeamer bestandenSongPro Text FilesSongPro tekstbestandenSongPro (Export File)SongPro (geëxporteerd bestand)In SongPro, export your songs using the File -> Export menuExporteer de liederen in SongPro via het menu File -> ExportSongShow Plus Song FilesSongShow Plus liedbestandenSongs Of Fellowship Song FilesSongs Of Fellowship liedbestandenThe Songs of Fellowship importer has been disabled because OpenLP cannot access OpenOffice or LibreOffice.Songs of Fellowship import is uitgeschakeld omdat OpenLP zowel OpenOffice als LibreOffice niet kan vinden op deze computer.SundayPlus Song FilesSundayPlus liedbestandenVideoPsalm FilesVideoPsalm-bestandenVideoPsalmVideoPsalmThe VideoPsalm songbooks are normally located in {path}Words Of Worship Song FilesWords Of Worship liedbestandenWorship Assistant FilesWorship Assistant bestandenWorship Assistant (CSV)Worship Assistant (CSV)In Worship Assistant, export your Database to a CSV file.Exporteer uw database naar een CSV-bestand vanuit Worship Assistant.WorshipCenter Pro Song FilesWorshipCenter Pro liedbestandenThe WorshipCenter Pro importer is only supported on Windows. It has been disabled due to a missing Python module. If you want to use this importer, you will need to install the "pyodbc" module.De WorshipCenter Pro-importeerder wordt alleen ondersteund op Windows. Het is uitgeschakeld door een missende Python-module. Als u deze importeerder wilt gebruiken, moet u de module "pyodbc" installeren.ZionWorx (CSV)ZionWorx (CSV)First convert your ZionWorx database to a CSV text file, as explained in the <a href="http://manual.openlp.org/songs.html#importing-from-zionworx">User Manual</a>.Converteer uw ZionWorx database eerst naar een CSV tekstbestand, zoals staat uitgelegd in de Engelstalige <a href="http://manual.openlp.org/songs.html#importing-from-zionworx">gebruikershandleiding</a>.SongsPlugin.LiveWorshipImportLoading the extracting dataSongsPlugin.LyrixImportFile {name}Bestand {name}Error: {error}Fout: {error}SongsPlugin.MediaFilesFormSelect Media File(s)Selecteer media bestand(en)Select one or more audio files from the list below, and click OK to import them into this song.Selecteer een of meerdere audiobestanden uit de lijst en klik OK om te importeren in dit lied.SongsPlugin.MediaItemCCLI LicenseTitlesTitelsSearch Titles...Zoek op titel...Maintain the lists of authors, topics and books.Beheer de lijst met auteurs, onderwerpen en liedboeken.Entire SongGehele liedSearch Entire Song...Doorzoek gehele lied...LyricsLiedtekstSearch Lyrics...Doorzoek liedtekst...Search Authors...Zoek op auteur...Search Topics...Zoeken onderwerpen...Search Songbooks...Zoek liedboek...CopyrightCopyrightSearch Copyright...Zoek Copyright...CCLI numberCCLI nummerSearch CCLI number...Zoek CCLI nummer...Are you sure you want to delete the following songs?copyFor song cloningkopieerMediaMediaCCLI License: CCLI Licentie: Failed to render Song footer html.
See log for detailsSongsPlugin.MediaShoutImportUnable to open the MediaShout database.Kan de MediaShout database niet openen.SongsPlugin.OPSProImportUnable to connect the OPS Pro database.Kon niet verbinden met de OPS Pro database."{title}" could not be imported. {error}SongsPlugin.OpenLPSongImportNot a valid OpenLP 2 song database.Geen geldige OpenLP 2 liederendatabase.SongsPlugin.OpenLyricsExportExporting "{title}"...Exporteren "{title}"...SongsPlugin.OpenSongImportInvalid OpenSong song file. Missing song tag.Ongeldig OpenSong-liedbestand. Ontbrekende liedtag.SongsPlugin.PowerPraiseImportInvalid PowerPraise song file. Missing needed tag.SongsPlugin.PowerSongImportNo songs to import.Geen liederen om te importeren.No {text} files found.Invalid {text} file. Unexpected byte value.Invalid {text} file. Missing "TITLE" header.Invalid {text} file. Missing "COPYRIGHTLINE" header.Verses not found. Missing "PART" header.Coupletten niet gevonden. Ontbrekende "PART" header.SongsPlugin.PresentationManagerImportFile is not in XML-format, which is the only format supported.File is not a valid PresentationManager XMl file.SongsPlugin.ProPresenterImportFile is not a valid ProPresenter XMl file.SongsPlugin.SingingTheFaithImportUnknown hint {hint}File {file}Error: {error}Fout: {error}SongsPlugin.SongBeamerImportFile is not a valid SongBeamer file.SongsPlugin.SongBookFormSongbook MaintenanceLiedboekbeheer&Name:&Naam:&Publisher:&Uitgever:You need to type in a name for the book.Er moet een naam worden opgegeven.SongsPlugin.SongExportFormFinished export. To import these files use the <strong>OpenLyrics</strong> importer.Klaar met exporteren. Om deze bestanden te importeren gebruik <strong>OpenLyrics</strong> importeren.Your song export failed.Liederen export is mislukt.Your song export failed because this error occurred: {error}SongsPlugin.SongImportCannot access OpenOffice or LibreOfficeKan OpenOffice of LibreOffice niet bereikenUnable to open fileKan bestand niet openenFile not foundBestand niet gevondencopyrightcopyrightThe following songs could not be imported:De volgende liederen konden niet worden geïmporteerd:SongsPlugin.SongMaintenanceFormCould not add your author.Kon de auteur niet toevoegen.This author already exists.Deze auteur bestaat al.Could not add your topic.Kon dit onderwerp niet toevoegen.This topic already exists.Dit onderwerp bestaat al.Could not add your book.Kon dit boek niet toevoegen.This book already exists.Dit boek bestaat al.Could not save your changes.De wijzigingen kunnen niet opgeslagen worden.The author {original} already exists. Would you like to make songs with author {new} use the existing author {original}?Could not save your modified author, because the author already exists.Kan de auteur niet opslaan, omdat deze reeds bestaat.The topic {original} already exists. Would you like to make songs with topic {new} use the existing topic {original}?Could not save your modified topic, because it already exists.Kan dit onderwerp niet opslaan, omdat het reeds bestaat.The book {original} already exists. Would you like to make songs with book {new} use the existing book {original}?Delete AuthorAuteur verwijderenAre you sure you want to delete the selected author?Weet u zeker dat u de auteur wilt verwijderen?This author cannot be deleted, they are currently assigned to at least one song.Deze auteur kan niet worden verwijderd omdat er nog een lied aan is gekoppeld.Delete TopicOnderwerp verwijderenAre you sure you want to delete the selected topic?Weet u zeker dat u dit onderwerp wilt verwijderen?This topic cannot be deleted, it is currently assigned to at least one song.Dit onderwerp kan niet worden verwijderd omdat er nog een lied aan is gekoppeld.Delete BookVerwijder boekAre you sure you want to delete the selected book?Weet u zeker dat u dit boek wilt verwijderen?This book cannot be deleted, it is currently assigned to at least one song.Dit boek kan niet worden verwijderd omdat er nog een lied aan is gekoppeld.SongsPlugin.SongProImportFile is not a valid SongPro file.SongsPlugin.SongSelectFormCCLI SongSelect ImporterCCLI SongSelect importeerderPreviewTitle:Titel:Author(s):Auteur(s):Copyright:Copyright:CCLI Number:CCLI-nummer:Lyrics:Teksten:BackWhen pressed takes user to the CCLI home pageImportImporterenCloseIncomplete songIncompleet liedThis song is missing some information, like the lyrics, and cannot be imported.Dit lied mist informatie, zoals bijvoorbeeld de liedtekst, waardoor het niet geïmporteerd kan worden.Song Duplicate WarningA song with the same CCLI number is already in your database.
Are you sure you want to import this song?Song ImportedLied geïmporteerdYour song has been importedSongsPlugin.SongShowPlusImportFile is not a valid SongShowPlus file.SongsPlugin.SongsTabSong related settingsEnable "Go to verse" button in Live panelUpdate service from song editLiturgie bijwerken met bewerkt liedImport missing songs from Service filesAdd Songbooks as first slideIf enabled all text between "[" and "]" will be regarded as chords.ChordsIgnore chords when importing songsSongSelect LoginUsername:Password:Chord notation to use:EnglishDutchGermanDuitsNeo-LatinFooterSong TitleAlternate TitleWritten ByAuthors when type is not setAuthors (Type "Words")Authors (Type "Music")Authors (Type "Words and Music")Authors (Type "Translation")Authors (Type "Words" & "Words and Music")Authors (Type "Music" & "Words and Music")Copyright informationSongbook EntriesCCLI LicenseSong CCLI NumberTopicsOnderwerpenPlaceholderDescriptionOmschrijvingcan be emptylist of entries, can be emptyHow to use Footers:Footer TemplateMako SyntaxReset TemplateSave Username and PasswordWARNING: Saving your SongSelect password is INSECURE, your password is stored in PLAIN TEXT. Click Yes to save your password or No to cancel this.SongsPlugin.TopicsFormTopic MaintenanceOnderwerp onderhoud Topic name:Onderwerp naam:You need to type in a topic name.U moet een onderwerp invullen.SongsPlugin.VerseTypeVerseCoupletChorusRefreinBridgeBridgePre-ChorusTussenspelIntroIntroEndingEindOtherOverigSongsPlugin.VideoPsalmImportError: {error}Fout: {error}SongsPlugin.WordsofWorshipSongImportInvalid Words of Worship song file. Missing {text!r} header.SongsPlugin.WorshipAssistantImportError reading CSV file.Fout bij het lezen van CSV bestand.Line {number:d}: {error}Regel {number:d}: {error}Decoding error: {error}Decoderen fout: {error}Record {count:d}Record {count:d}File not valid WorshipAssistant CSV format.Bestand is geen geldig WorshipAssistant CSV-bestand.SongsPlugin.WorshipCenterProImportUnable to connect the WorshipCenter Pro database.Kon niet verbinden met de WorshipCenter Pro database.SongsPlugin.ZionWorxImportError reading CSV file.Fout bij het lezen van CSV bestand.Line {number:d}: {error}Regel {number:d}: {error}Record {index}Record {index}Decoding error: {error}Decoderen fout: {error}File not valid ZionWorx CSV format.Bestand heeft geen geldige ZionWorx CSV indeling.Record %dVermelding %dWizardWizardWizardThis wizard will help you to remove duplicate songs from the song database. You will have a chance to review every potential duplicate song before it is deleted. So no songs will be deleted without your explicit approval.Deze assistent zal u helpen om dubbele liederen uit de database te verwijderen. U heeft de mogelijkheid om ieder lied te bekijken voordat die verwijderd wordt. Er zullen geen liederen worden verwijderd zonder uw expliciete toestemming.Searching for duplicate songs.Zoeken naar dubbele liederen.Please wait while your songs database is analyzed.Een moment geduld. De liederendatabase wordt geanalyseerd.Here you can decide which songs to remove and which ones to keep.Hier kunt u bepalen welke liederen moeten worden verwijderd of bewaard.Review duplicate songs ({current}/{total})InformationInformatieNo duplicate songs have been found in the database.Er zijn geen dubbele liederen gevonden in de database.common.languages(Afan) OromoLanguage code: om(Afan) OromoAbkhazianLanguage code: abAbkhazischAfarLanguage code: aaAfarAfrikaansLanguage code: afAfrikaansAlbanianLanguage code: sqAlbanischAmharicLanguage code: amAmharischAmuzgoLanguage code: amuAmuzgoAncient GreekLanguage code: grcKlassiek grieksArabicLanguage code: arArabischArmenianLanguage code: hyArmenischAssameseLanguage code: asAssameesAymaraLanguage code: ayAymaraAzerbaijaniLanguage code: azAzerbaijaansBashkirLanguage code: baBashkirBasqueLanguage code: euBaskischBengaliLanguage code: bnBengaalsBhutaniLanguage code: dzBhutaansBihariLanguage code: bhBiharischBislamaLanguage code: biBislamischBretonLanguage code: brBretonsBulgarianLanguage code: bgBulgaarsBurmeseLanguage code: myBurmeesByelorussianLanguage code: beWit-RussischCakchiquelLanguage code: cakCakchiquelCambodianLanguage code: kmCambodjaansCatalanLanguage code: caCatalaansChineseLanguage code: zhChineesComaltepec ChinantecLanguage code: ccoComaltepec ChinantecCorsicanLanguage code: coCorsicaansCroatianLanguage code: hrKroatischCzechLanguage code: csTsjechischDanishLanguage code: daDeensDutchLanguage code: nlNederlandsEnglishLanguage code: enDutchEsperantoLanguage code: eoEsperantoEstonianLanguage code: etEstsFaeroeseLanguage code: foFaeroeesFijiLanguage code: fjFijiFinnishLanguage code: fiFinsFrenchLanguage code: frFransFrisianLanguage code: fyFriesGalicianLanguage code: glGalicischGeorgianLanguage code: kaGeorgischGermanLanguage code: deDuitsGreekLanguage code: elGriesGreenlandicLanguage code: klGroenlandsGuaraniLanguage code: gnGuaranischGujaratiLanguage code: guGujaratischHaitian CreoleLanguage code: htHaitiaans CreoolsHausaLanguage code: haHebrew (former iw)Language code: heHiligaynonLanguage code: hilHindiLanguage code: hiHungarianLanguage code: huIcelandicLanguage code: isIndonesian (former in)Language code: idInterlinguaLanguage code: iaInterlingueLanguage code: ieInuktitut (Eskimo)Language code: iuInupiakLanguage code: ikIrishLanguage code: gaItalianLanguage code: itJakaltekoLanguage code: jacJapaneseLanguage code: jaJavaneseLanguage code: jwK'iche'Language code: qucKannadaLanguage code: knKashmiriLanguage code: ksKazakhLanguage code: kkKekchí Language code: kekKinyarwandaLanguage code: rwKirghizLanguage code: kyKirundiLanguage code: rnKoreanLanguage code: koKurdishLanguage code: kuLaothianLanguage code: loLatinLanguage code: laLatvian, LettishLanguage code: lvLingalaLanguage code: lnLithuanianLanguage code: ltMacedonianLanguage code: mkMalagasyLanguage code: mgMalayLanguage code: msMalayalamLanguage code: mlMalteseLanguage code: mtMamLanguage code: mamMaoriLanguage code: miMaoriLanguage code: mriMarathiLanguage code: mrMoldavianLanguage code: moMongolianLanguage code: mnNahuatlLanguage code: nahNauruLanguage code: naNepaliLanguage code: neNorwegianLanguage code: noOccitanLanguage code: ocOriyaLanguage code: orPashto, PushtoLanguage code: psPersianLanguage code: faPlautdietschLanguage code: pdtPolishLanguage code: plPortugueseLanguage code: ptPunjabiLanguage code: paQuechuaLanguage code: quRhaeto-RomanceLanguage code: rmRomanianLanguage code: roRussianLanguage code: ruSamoanLanguage code: smSangroLanguage code: sgSanskritLanguage code: saScots GaelicLanguage code: gdSerbianLanguage code: srSerbo-CroatianLanguage code: shSesothoLanguage code: stSetswanaLanguage code: tnShonaLanguage code: snSindhiLanguage code: sdSinghaleseLanguage code: siSiswatiLanguage code: ssSlovakLanguage code: skSlovenianLanguage code: slSomaliLanguage code: soSpanishLanguage code: esSudaneseLanguage code: suSwahiliLanguage code: swSwedishLanguage code: svTagalogLanguage code: tlTajikLanguage code: tgTamilLanguage code: taTatarLanguage code: ttTeguluLanguage code: teThaiLanguage code: thTibetanLanguage code: boTigrinyaLanguage code: tiTongaLanguage code: toTsongaLanguage code: tsTurkishLanguage code: trTurkmenLanguage code: tkTwiLanguage code: twUigurLanguage code: ugUkrainianLanguage code: ukUrduLanguage code: urUspantecoLanguage code: uspUzbekLanguage code: uzVietnameseLanguage code: viVolapukLanguage code: voWelchLanguage code: cyWolofLanguage code: woXhosaLanguage code: xhYiddish (former ji)Language code: yiYorubaLanguage code: yoZhuangLanguage code: zaZuluLanguage code: zu